Protein information for: OR7E66P



NSTDXQSLTGVSIFLLLELSEDPELQPVLAGLFLSMCLVKVLGNLLIILA
ISPDSHLHTPMYFFLSNLSLPDIGFTSTTVPKMIVDIQSHSRVISYAGCL
TQMSLFAIFGGEEDMLLSVMAYDWFVAICHPLYHSAIMNPCFCGFLVLLS
FFFSFSQLHNLIALQMTCFKNVGIPNFLCDPSQLPHLTCCDTFTNHIIMY
FPAAIFGFLPISGTLFSYHVIVSSILRVSSSGGRCKAFPICGVVCXYYGT
GFGGYLSSDVSSSLRKAAVASVMYMVVTPMLNPFIYSLRNRDIKSVVQRP
HGSTV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 QPVLAGLFLSMCLVKVLGNLLIILAIS
TM2 63 85 FFLSNLSLPDIGFTSTTVPKMIV
TM3 100 120 LTQMSLFAIFGGEEDMLLSVM
TM4 143 163 CGFLVLLSFFFSFSQLHNLIA
TM5 198 219 IMYFPAAIFGFLPISGTLFSYH
TM6 241 261 CGVVCXYYGTGFGGYLSSDVS
TM7 267 286 AAVASVMYMVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage