Protein information for: OR7E84P



NDTDPQSLTDVSIFLLLELSEDPELQPVIAGLFLSMCLVTVLGNLLIIMA
VSPDFHLHTPMYFFLSNLSLPDIGFTSTTVPKMIVDIQSHSRVISYAGCL
TQMSLFAIFGGEENMLLSVMAYDQFVAICHPPYRSAILNSFQVCCPCFFS
FFFFFFLRLLDSQLHNLIALQMTCFKDVEISNVFWEPSQLPHLACCDTFT
RNINLYFPAAVLGFLPISGTLFSYCKIVSSILRVSSSGGKYKAFSTCGSH
LSAVCXFYGTGVGGYLGSDVSSSPRKSAVASVMYTVVTPMLNPFIYSLRN
RDMKSVLRRPHSSTV
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 QPVIAGLFLSMCLVTVLGNLLIIMAVS
TM2 63 85 FFLSNLSLPDIGFTSTTVPKMIV
TM3 100 120 LTQMSLFAIFGGEENMLLSVM
TM4 147 167 CFFSFFFFFFLRLLDSQLHNL
TM5 204 225 NLYFPAAVLGFLPISGTLFSYC
TM6 247 271 CGSHLSAVCXFYGTGVGGYLGSDVS
TM7 277 296 SAVASVMYTVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage