Protein information for: OR7E89P



LVFIFYFSNPLSFSRCPRHTEPRNLTGVXFLLLGLSEDPELLPVLALLSL
SLSMYLVMVLRNLLSILAVSSDPLHTPVYFFLSNLCWADIGFTSPTVPKM
IVDMQSHSRVISHAGCLAQMSFLVLFACIEDMLLTVMAYDSFVAICHPLH
YPVIMNPHLCVFFVLVSFFLSLLDSQLHGWIVLQFTIIKNVEISNFLCDP
SQLLKLACSDSVTNSIFIYFDSTMFGFLPISGILLSXYKIVPSILRMSSS
DGKYKAFTTCGSHLAVVCXFDGTGIGMYLTSALSPPPRNGVAASVMYAVV
TPMLNLFIYSLRNRDIQSALRRLRSRTVESHDLFHPFSCV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 44 70 VLALLSLSLSMYLVMVLRNLLSILAVS
TM2 80 102 FFLSNLCWADIGFTSPTVPKMIV
TM3 117 137 LAQMSFLVLFACIEDMLLTVM
TM4 160 180 CVFFVLVSFFLSLLDSQLHGW
TM5 217 238 FIYFDSTMFGFLPISGILLSXY
TM6 260 284 CGSHLAVVCXFDGTGIGMYLTSALS
TM7 290 309 GVAASVMYAVVTPMLNLFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage