Protein information for: OR7E90P



LVFIFYFSNPLSFSRCPRHTEPRNLTGVXFLLLGLSEDPELQPVLALLSL
SLSMSMYLVTVLRNLLSILAVSSDSQLHTPMYFFLSNLCWADIGFTSPMV
PKMIMDMQSHSRVISHAGCLTRMSFLVLFACIEDMLLTVMAYDCFVAICR
PLHYPVIMNPHLCVFFVLVSFFLSLLDSQLHSXIVLQFTFFNNVEIANFV
YEPSQLLNLDCSDTVINSVFIYFDSMFGFLPISGILLSXYKIVPSILRMS
SSDGKYKAFATCGSHLAVVCXFDGTGIGMYLTSAVSPPPRNGVAASVMYA
VVTPMLNLFIYSLRNRDIQSALQRLSSRTVESHDLFHPFSCV
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 46 72 ALLSLSLSMSMYLVTVLRNLLSILAVS
TM2 83 105 FFLSNLCWADIGFTSPMVPKMIM
TM3 120 140 LTRMSFLVLFACIEDMLLTVM
TM4 163 183 CVFFVLVSFFLSLLDSQLHSX
TM5 220 241 FIYFDSMFGFLPISGILLSXYK
TM6 262 286 CGSHLAVVCXFDGTGIGMYLTSAVS
TM7 292 311 GVAASVMYAVVTPMLNLFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage