Protein information for: OR7E94P



LFFIFSNPLFFSRCPSHTEPQNLTGVSEFLLLGLSEDPELQPVLAWLSLS
IYLVTVLGNLLIILAVSSDSHLHTPIYFFLFNLSLADIGFTSAMVPKMIV
DMQSHSRVISYAGCLTXMSFFVLFFSIIDYTLSSRVHVHNVQVCYICIHV
PCWCAAPINSSFTLGISSNVIPPSSPQPTTGPSVXCSPSXCPSVLIVQFQ
PVSENMRCLVFCPCNSLLRMMVSSFIHVPTKYMNSSLFMAAXYSMEDMSN
VXRLXIRQITHKXNMSCSSYLDTYTLIATRSMYIQMHMYAKAVYFYMTAS
QXNNKRAXFNYYCAFLNVLFRPAVLXQIIKXRYIIHKYIF
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 41 67 QPVLAWLSLSIYLVTVLGNLLIILAVS
TM2 78 100 FFLFNLSLADIGFTSAMVPKMIV
TM3 115 135 LTXMSFFVLFFSIIDYTLSSR
TM4 154 174 CAAPINSSFTLGISSNVIPPS
TM5 210 231 VFCPCNSLLRMMVSSFIHVPTK
TM6 259 283 ITHKXNMSCSSYLDTYTLIATRSMY
TM7 290 309 AKAVYFYMTASQXNNKRAXF

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage