Protein information for: OR7L1P



MISSDEENDTNMMEFILVGLSRQPASQLLFFXAILFIYSVTLVGNILIIV
IIQIDSHLQTPMYFFLIQVSFLDICSTPTVLVNCXKDFPSVSYSGCLFXM
TIFLYLGVTECVFFLFCFVLFFDVGVSLCHLGWSAMAQSWLPATSTSWVQ
TVRLPQPPEXLGLQVPATMTSXFLYFXXRRGFTILVRLVLNSXPHDPPAL
ASQSVGITGVSHHAQPSVFLLLLWPMTGLLPSQNPCVTHSLSIAMFXIWM
VAGVWALLVAPIQFCGHNVVNHFTCELQVIFKLTCSPVLVKEIQXFMIPG
CTLXALYQHXVCSYSXARQQTTSQELRGIQLGHKVRYYRGTLTQSMLKLT
QPIAIMTIELAHRXS
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 QLLFFXAILFIYSVTLVGNILIIVIIQ
TM2 64 86 FFLIQVSFLDICSTPTVLVNCXK
TM3 97 116 LFXMTIFLYLGVTECVFFLF
TM4 140 160 WLPATSTSWVQTVRLPQPPEX
TM5 219 240 FLLLLWPMTGLLPSQNPCVTHS
TM6 270 294 VNHFTCELQVIFKLTCSPVLVKEIQ
TM7 305 324 ALYQHXVCSYSXARQQTTSQ

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage