Protein information for: OR8A3P



LCLEEKKNHSTVTEFILRGLTKQPDFQLPLFLLFLRICLVTMVGNLGMIS
LIWLNSQLHTPTYYFFSNLSLVDLFYSSIITPKMLVNFVPEKNIISYAER
GIRENAPFPLKXCCSXWMSCIICFFL
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 QLPLFLLFLRICLVTMVGNLGMISLIW
TM2 64 86 YFFSNLSLVDLFYSSIITPKMLV
TM3 92 94 NII
TM4 112 125 CCSXWMSCIICFFL
TM5 126 125
TM6 126 125
TM7 126 125

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage