Protein information for: OR8B5P



MAPGNGSLMNEFILVGLTDXPDLXLPLFFMFLVMYVVTVIRNFVLVILTM
RNSRLHTPKYFFLSKLFFTDLCYSSVFILQLPRKCISEENVISYMVCMIX
FCFFFFLIISECYMLTSMAYDCCVAICYPLLYHIAMSPKVCFSLMLGSYF
LSFSGAMAHTGCMLRLTCDANTINHYFRDILPVFQLSCTSTYINELVVFI
VAGINTIVPTVTVFISYGDILSRILHISSNEGRSKAFSTCSSHIIAVSLF
FGLSAFMYLKPSSAGSMDEGKFSSVFYMNGLPMMSSLIYSLRRKDVKFAM
GKSLSRRMFLP
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 XLPLFFMFLVMYVVTVIRNFVLVILTM
TM2 61 83 FFLSKLFFTDLCYSSVFILQLPR
TM3 98 118 MIXFCFFFFLIISECYMLTSM
TM4 141 161 CFSLMLGSYFLSFSGAMAHTG
TM5 197 218 VVFIVAGINTIVPTVTVFISYG
TM6 240 264 CSSHIIAVSLFFGLSAFMYLKPSSA
TM7 270 289 GKFSSVFYMNGLPMMSSLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage