Protein information for: OR8B6P



FFSCVHRYPQRRMAPGNGFFMTKIILLELTDQPDLQLPLFFLFLGMVTAL
GNLVLVTLVVLNSHLHTPMYFFLFNLSFIDLCYSSVFTPQMLMNFITQKD
IISHMGCMSQLFFFLYCFFGECYVLTSMAYDRAVAICNPLLYNIAMSPKV
YSHLMLGLYLLAFSSAMAHTGCMLRLTFCDANTIHPYLCDILPLLQLSCT
GTYINELVVSIAAVIISTVTIFISCGCSSYIILHINSKEGRSKALNTCSS
NLIAVCSXFGSCAFMCLKPSSAGSMDEGKISSVFYTNTAPLMNPLIYSLM
NKDVQLSLRKKPCRKKF
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 34 60 DLQLPLFFLFLGMVTALGNLVLVTLVV
TM2 71 93 FFLFNLSFIDLCYSSVFTPQMLM
TM3 108 128 MSQLFFFLYCFFGECYVLTSM
TM4 151 171 YSHLMLGLYLLAFSSAMAHTG
TM5 208 229 VVSIAAVIISTVTIFISCGCSS
TM6 248 272 CSSNLIAVCSXFGSCAFMCLKPSSA
TM7 278 297 GKISSVFYTNTAPLMNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage