Protein information for: OR8B7P



MAPGNISTVAELILVGLKDQTDLQPPLFFLFLVMGVVAGXGNLGLVTLIV
FSSYFHAPMYFFLFSLAFIDHFYSSVFIPKMLMNFITEKNIISYAGCMSA
FFSFFFFVISECYVLTSMVSDHYVAMAICPLLYNIAMSPKVCSSHMLGSY
FWPFSGAMAHTRCMLKLTSCEANTINHYFCDTLHLLQLSCTSTYVSELMV
FIAAGIIFTVPSITIFISYFFTSPLSYHFTEGWSKFFSTCSFHKIAISLF
FGLGASLCLKLSSTGTINEGKISSVFHIDVVPMINSSIYSLRNNDVKLAW
RKILSWRKFPFE
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QPPLFFLFLVMGVVAGXGNLGLVTLIV
TM2 61 83 FFLFSLAFIDHFYSSVFIPKMLM
TM3 98 118 MSAFFSFFFFVISECYVLTSM
TM4 142 162 CSSHMLGSYFWPFSGAMAHTR
TM5 199 220 MVFIAAGIIFTVPSITIFISYF
TM6 240 264 CSFHKIAISLFFGLGASLCLKLSST
TM7 270 289 GKISSVFHIDVVPMINSSIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage