Protein information for: OR8H2



MMGRRNNTNVADFILMGLTLSEEIQMALFMLFLLIYLITMLGNVGMILII
RLDLQLHTPMYFFLTHLSFIDLSYSTVVTPKTLANLLTSNYISFTGCFAQ
MFFFAFLGTAECYLLSSMAHDRYAAICSPLHYTVIMSKRLCLALITGPYV
IGFIDSFVNVVSMSRLHFYDSNVIHHFFCDTSPILALSCTDTYNTEILIF
IIVGSTLMVSLFTISASYVFILFTILKINSTSGKQKAFSTCVSHLLGVTI
FYSTLIFTYLKPRKSYSLGRDQVASVFYTIVIPVLNPLIYSLRNKEVKNA
VIRVMQRRQDSR
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 25 51 QMALFMLFLLIYLITMLGNVGMILIIR
TM2 62 84 FFLTHLSFIDLSYSTVVTPKTLA
TM3 98 118 FAQMFFFAFLGTAECYLLSSM
TM4 141 161 CLALITGPYVIGFIDSFVNVV
TM5 198 219 LIFIIVGSTLMVSLFTISASYV
TM6 241 265 CVSHLLGVTIFYSTLIFTYLKPRKS
TM7 271 290 DQVASVFYTIVIPVLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage