Protein information for: OR8I1P



LIXTAGSNFTEVTVFILSGYANHPELQVSFFLMFLFIYLFTILGNLGLIM
LIRMDSQLHTPMYFFLSNLAFIDIFYSSSVTPKTLANFQSNQRSISFVGC
FVQMYFSVGLVCTECFLLGSMAYDCYVAIWPYSVVISXKACNWLGVMSYT
IGFTNSLVSVCVIRVLFCDSSINFFFCDTTALLALSCVDAFSTEMVSFAL
AGFTLLGSILIITVTYIAITSAILKNQWAAGWQKAFSTCAFHLTGLTIFY
GSLIFTYLQLDKTSSLIHAQLAFVFYMTVIPMLNPLIXSLRNKDVKNALS
RVIHRKLFP
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 QVSFFLMFLFIYLFTILGNLGLIMLIR
TM2 64 86 FFLSNLAFIDIFYSSSVTPKTLA
TM3 101 121 FVQMYFSVGLVCTECFLLGSM
TM4 140 160 ACNWLGVMSYTIGFTNSLVSV
TM5 195 216 MVSFALAGFTLLGSILIITVTY
TM6 238 262 TCAFHLTGLTIFYGSLIFTYLQLDK
TM7 268 286 AQLAFVFYMTVIPMLNPLI

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage