Protein information for: OR8L1P



MKYFYTYFMAKTNNSEVTEFILLGLTDNPELQALFWGIFLVINLSSVMGS
LGLIMLIHISPQLHTAMYFFLSHVAFVYFCYTSSITPNSLVNLLQETKRI
SLPTCASQLHCFIMFVVCDMYVLSAMAYDRYVAICNPLLYSIIMNRRVCI
QMVVSTYLYGFSVRLLQAILTFHLSFXDSNIINNSYCDDVPLACLPYHKN
DVKELILFTLAGFNTLFSLLIILISYISVLSAILRINSAESRQKAFSTCD
SHLTSIIIFYGIITFMYMQXKTNNSLDTDKIASVFCIVKIPSIYSLRNHE
VKDALKMIMENLCLT
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 32 58 QALFWGIFLVINLSSVMGSLGLIMLIH
TM2 69 91 FFLSHVAFVYFCYTSSITPNSLV
TM3 106 126 ASQLHCFIMFVVCDMYVLSAM
TM4 149 169 CIQMVVSTYLYGFSVRLLQAI
TM5 206 227 ILFTLAGFNTLFSLLIILISYI
TM6 249 273 CDSHLTSIIIFYGIITFMYMQXKTN
TM7 278 293 DKIASVFCIVKIPSIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage