Protein information for: OR8Q1P



MAAESHSTVTEFILRKKQQGLQLPLFXGFCLKTVVGALILITLVFLNSQL
HPPMYYVIRNLSFMDHCNCSISTPKILVKFVLEKTIISYEDGMSQLCSAC
VFILSWPSVTCGPATAVITFHQVSSLLVVVVFIWSXLVQQXIFCLVLKXY
XCELLSVILLSCTSIYDIDRTIFFFTXCNIVVTRLTVVSYSLILSSILHI
SFTKGKLWVFPVGLTHSC
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 19 45 QGLQLPLFXGFCLKTVVGALILITLVF
TM2 56 78 YVIRNLSFMDHCNCSISTPKILV
TM3 95 115 QLCSACVFILSWPSVTCGPAT
TM4 126 146 LLVVVVFIWSXLVQQXIFCLV
TM5 156 174 VILLSCTSIYDIDRTIFFF
TM6 188 212 VSYSLILSSILHISFTKGKLWVFPV
TM7 218 217

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage