Protein information for: OR8T1P



MRNRSVVPEFVLLGLSAGPQTQTLLFVLFVVICLLTVMGNLLLLVVINAD
SCLHTPMYFFLGQLSFLDLCHSSVTAPKLLENLLSEKKTISVEGCMAXVF
FVFATGGTESSLLAVMAYDRYVAISSPLLYGQVMNRQLCSGLVGGSWGLA
FLDALINILVALNLDFCEAQNIHHFSCELPSLYPLSCSDVSASFTTLLCS
SFLHFFGNFLMIFLSYICILSTILRISSTTGRSKAFSTCSSHLTAVIFFY
GSGLLRYLMPNSGSIQELIFSLQYSVITPMLNLLIYSLKNREVKAAVRRT
LRKYF
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QTLLFVLFVVICLLTVMGNLLLLVVIN
TM2 59 81 FFLGQLSFLDLCHSSVTAPKLLE
TM3 96 116 MAXVFFVFATGGTESSLLAVM
TM4 139 159 CSGLVGGSWGLAFLDALINIL
TM5 196 217 TLLCSSFLHFFGNFLMIFLSYI
TM6 239 263 CSSHLTAVIFFYGSGLLRYLMPNSG
TM7 267 286 ELIFSLQYSVITPMLNLLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage