Protein information for: OR8X1P



MAVENNSSVTEFILVRLTNSRCPSVLFLMWSLWGEFEHNFMSLNSHLHTP
THFFLFTLSFIDVCYSFVCTTKIPMGFISERNIISFVGWPTXLYFFCIFV
KEKNGVIVGIMFSAKMLVCREIMDXSLMXNXKMHMALERSDFRMGXTGSA
TKKHLIIFLYYSDXFPEIVRLQSFGTRFLSEARHTLXNCTCTLKSLLHII
ICFYIWKQKKISYLYHKSXKMDLYKIFMFCGLLTRKIFSVHFYFSNGSGK
MLLKGYIXFWRMSLPMCAIFIFVRRYYYLLKKLKTLLYK
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 19 41 SRCPSVLFLMWSLWGEFEHNFMS
TM2 53 75 FFLFTLSFIDVCYSFVCTTKIPM
TM3 90 110 PTXLYFFCIFVKEKNGVIVGI
TM4 134 154 HMALERSDFRMGXTGSATKKH
TM5 176 197 TRFLSEARHTLXNCTCTLKSLL
TM6 219 243 XKMDLYKIFMFCGLLTRKIFSVHFY
TM7 253 272 LKGYIXFWRMSLPMCAIFIF

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage