Protein information for: OR9A2



MMDNHSSATEFHLLGFPGSQGLHHILFAIFFFFYLVTLMGNTVIIVIVCV
DKRLQSPMYFFLSHLSTLEILVTTIIVPMMLWGLLFLGCRQYLSLHVSLN
FSCGTMEFALLGVMAVDRYVAVCNPLRYNIIMNSSTCIWVVIVSWVFGFL
SEIWPIYATFQFTFRKSNSLDHFYCDRGQLLKLSCDNTLLTEFILFLMAV
FILIGSLIPTIVSYTYIISTILKIPSASGRRKAFSTFASHFTCVVIGYGS
CLFLYVKPKQTQGVEYNKIVSLLVSVLTPFLNPFIFTLRNDKVKEALRDG
MKRCCQLLKD
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 23 49 HHILFAIFFFFYLVTLMGNTVIIVIVC
TM2 60 82 FFLSHLSTLEILVTTIIVPMMLW
TM3 94 114 SLHVSLNFSCGTMEFALLGVM
TM4 137 157 CIWVVIVSWVFGFLSEIWPIY
TM5 194 215 ILFLMAVFILIGSLIPTIVSYT
TM6 237 261 FASHFTCVVIGYGSCLFLYVKPKQT
TM7 267 286 NKIVSLLVSVLTPFLNPFIF

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage