Protein information for: OR9G2P



YSKEIIEXCTSNDIIKCGXHNKITFFTFILLEFTEDLGLQQVLFFIFLII
YVISLSGNIILNSLICADSWPYTPMYFFTGNRFLLDLWYSSVHIPDILLT
CISDDKTISFPGCLAQFFSAVLAXNECYMMASMAYDRYMAISKPLLYSRA
TFPELCASLVEASHLGGFVNSTIITSETPTLSFCGSNIIDDFFCDLPPLV
KLVCDVKERYQAVLHFMLASNHHSHCTYSCVHLFIIAAISKIRSIKGRLQ
VFSTCGSPLTALTLYYGAIFFIYSQPRTSYALKMDKLGSVFYTVVIPMLN
PLIYSLRNKDVKDALKKMLDRLQFLKEKY
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 40 66 QQVLFFIFLIIYVISLSGNIILNSLIC
TM2 77 99 FFTGNRFLLDLWYSSVHIPDILL
TM3 114 133 LAQFFSAVLAXNECYMMASM
TM4 156 176 CASLVEASHLGGFVNSTIITS
TM5 213 234 VLHFMLASNHHSHCTYSCVHLF
TM6 255 279 CGSPLTALTLYYGAIFFIYSQPRTS
TM7 285 304 DKLGSVFYTVVIPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage