Protein information for: OR9G3P



MQRSNHTVTEFILLGFTTDPGMQLGLFVVFLGVYCLTVVGSSTLIVLICN
DSHLHTPMYFVIGNLSFLDLWYSSVYTPKILVTCISEDKSISFAGCLCQF
FSARLAYSECYLLAAMAYDHYVAISKPLLYAQTMPRRLCIWLVLYSYTGG
FVNAIILTSNTFTLDFCGDNVIDDFFCDVPPLVKLACSVRATRLWLHFLL
ASNVISPTVLILASYLSIITTILRIHSTQGRIKVFSTCSSHLISVTLYYG
SILYNYSRPSSSYSLKRDKMVSTFYTMLFPMLNPMIYSLRNKDMKDALKK
FFKSA
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 23 49 QLGLFVVFLGVYCLTVVGSSTLIVLIC
TM2 60 82 FVIGNLSFLDLWYSSVYTPKILV
TM3 97 116 LCQFFSARLAYSECYLLAAM
TM4 139 159 CIWLVLYSYTGGFVNAIILTS
TM5 195 216 WLHFLLASNVISPTVLILASYL
TM6 238 262 CSSHLISVTLYYGSILYNYSRPSSS
TM7 268 287 DKMVSTFYTMLFPMLNPMIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage