Protein information for: OR9I2P



LMRLYYYYFLISVDNVGFMAESGTTVTEFFLRGFRLKAELQIGLFFVFLV
IFLITMGGNLGVLILIQTDPRLQTPMYFFLSHLSFLDICYSSVIGPQLLV
DFGTDKMIITYERCASQFFFFTLCASIECFLLAVMAYDRYVAVCNPLLYA
IVMTPKTRLALLAGAYSGAIVNSVICTGCTFSISFSKSNHVDFFFCDLPP
LLKLACSETRPREWVIYLSAFLVITTSISVILTSYLFIIQSVLKIRTAGG
RAKTFSTCASHMTALTLFFGTLIFIYLKGNMGESLEEDKIVSIFYTVVIP
MLNPMIYSLRNKDMKEALKKVFNRIRVSQAE
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 41 67 QIGLFFVFLVIFLITMGGNLGVLILIQ
TM2 78 100 FFLSHLSFLDICYSSVIGPQLLV
TM3 115 135 ASQFFFFTLCASIECFLLAVM
TM4 158 178 RLALLAGAYSGAIVNSVICTG
TM5 215 236 VIYLSAFLVITTSISVILTSYL
TM6 258 282 CASHMTALTLFFGTLIFIYLKGNMG
TM7 288 307 DKIVSIFYTVVIPMLNPMIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage