Protein information for: OR9K1P



MGDKGTGNHSDVTDFILEGFRVRPEFYILLFFLFLLIYSMVLLGNISVMT
IIVTDSQLNTPMYFFLGNLSFIDVSYSTVIAPKAMAHFLSEKKTVSFAGC
VAQLFLFALFIVTEGFVLAAMAYDRFSAICNPLLHSVHMSRRLCTQLVAG
SYFCGWASSILQVSVTFSVSFCASRVIAHFYCDSYQIEKISCSNLFVNKM
VSLSLSVIIILPTIVVIIVSYLYIVSSVLKIPSSEGRKKDFSTCSSHLGV
VSLLXGTVSFVYLTPPSNPELRKVASVFYILVTPMLNPLIYSLRNKDVKE
ALRKILCNKKALS
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 YILLFFLFLLIYSMVLLGNISVMTIIV
TM2 64 86 FFLGNLSFIDVSYSTVIAPKAMA
TM3 101 121 VAQLFLFALFIVTEGFVLAAM
TM4 144 164 CTQLVAGSYFCGWASSILQVS
TM5 201 222 VSLSLSVIIILPTIVVIIVSYL
TM6 244 268 CSSHLGVVSLLXGTVSFVYLTPPSN
TM7 273 290 VASVFYILVTPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage