Protein information for: OR9L1P



TEKNLISMNGFMNFTDYPELEMPLFLVFLSCFLAIILRNMEWVILTQVNV
HLFTPIYFFLTNVTLWDTSVIMPQILAILATGKTTISYGRXXKQLRSFFF
ICVGTXCFLPTAMTISSPLPHTTTMNFKTCWGICTCWVLMVNVVNAYTXG
LSGATFNTICTFARFFCDDNXIKFCHILPLLKLIXNTSGNSKIIIVILTA
FMIIAGTRVILISYLLIIRALRMKSSSGRSQXFYPSTCASHLTAMTFLWD
PHLQTCEVPQINPLTEDKLASLTCTIFIPMLELLIQSLKKDIQVAFKKAI
GNFWVFERL
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 21 47 EMPLFLVFLSCFLAIILRNMEWVILTQ
TM2 58 77 FFLTNVTLWDTSVIMPQILA
TM3 94 113 QLRSFFFICVGTXCFLPTAM
TM4 139 159 LMVNVVNAYTXGLSGATFNTI
TM5 194 215 IIVILTAFMIIAGTRVILISYL
TM6 238 262 CASHLTAMTFLWDPHLQTCEVPQIN
TM7 267 285 KLASLTCTIFIPMLELLIQ

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage