Protein information for: OR9M1P



MELENGTVKTGFFLLGFSDHLELQSLLFAEFFSIYSVTLMGNLGMILLIT
ISSHLHTPMYFFLCVLSFIDACYSSVIAPKLLVNLVSEKKTISYNGCVAQ
LYFFCSLVDTESFLLAAMAXDRYIAICNPLLYTVIMSKKVCCQLAIGAFL
GGTMSSIIHTTNTFHLSFCSRDINHFFCDISPLFSLSCTDTYMHDIILVV
FASFVEAICLLSVLLSYVFIMAAILRTGSVEGRRRGFSTCASHLTVVTMY
HGTLIFIYLRPSTGHSLDIDKVTSVFYTLIIPMLNPLIYSLRNKDVKNAF
RKVIGRKLLP
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QSLLFAEFFSIYSVTLMGNLGMILLIT
TM2 61 83 FFLCVLSFIDACYSSVIAPKLLV
TM3 98 118 VAQLYFFCSLVDTESFLLAAM
TM4 141 161 CCQLAIGAFLGGTMSSIIHTT
TM5 197 218 ILVVFASFVEAICLLSVLLSYV
TM6 240 264 CASHLTVVTMYHGTLIFIYLRPSTG
TM7 270 289 DKVTSVFYTLIIPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage