Protein information for: OR9R1P



MKSELNRNYSEVTEFILLGFRTSPEAQILLFFLFLLIYMVIVLRNLSMLV
VIEIDSRLHTPVYFFLRNLSYLDLRYSTVIAPKLTTLFSKEKKISYNGXA
TQLFFFALFVGTEGFFLDMMAYDRFSAICSPFFYTVCMSQQACVCLVVGS
SICGCINSMIQTGFTFSLHFCGENRLEHFFCDVSVMIKISCIDILVNEVV
LFILSALITTTTTVILASYVHILSTVLKILSTHGRRKTFSTCSSHITVVS
LFYGTVFFMYAQPGASPKSKVIVVFXTLVIPMLNTLIYSLRNRCKDALKR
TLIRKISFHWPLAIYKTI
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 27 53 QILLFFLFLLIYMVIVLRNLSMLVVIE
TM2 64 86 FFLRNLSYLDLRYSTVIAPKLTT
TM3 100 120 ATQLFFFALFVGTEGFFLDMM
TM4 143 163 CVCLVVGSSICGCINSMIQTG
TM5 200 220 VLFILSALITTTTTVILASYV
TM6 242 266 CSSHITVVSLFYGTVFFMYAQPGAS
TM7 269 288 SKVIVVFXTLVIPMLNTLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage