Protein information for: OR9S24P



MFIDXKKVIYXNIIFYFICISVFYYTLSSGIDVQNMQVCYIGIHVPWWFA
ASINPSSTLGISPNSIPPRVPHPQEAHTHSGXCSPPYVHVFSLFNSHLXV
GTCGVWFTVPVLVCXVMVCQLHSCPCKGHELILFYGCIVYHGVYVPHFLX
PVYHXWAFGXVPSLCYCEQCCNKHTCTCVFIVEXFIIFWVYTQXWDCXLI
MVGVTFVVLISCGYTPATILRMYSAVRGCKIFSTCGSHITTVPLFPGTVF
VMYAQLGPVESMEQGKAISIFYTLLIPTLNPLMYSLRNNDVKIALKRLGQ
KHTAMXRRVA
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 12 38 NIIFYFICISVFYYTLSSGIDVQNMQV
TM2 49 71 FAASINPSSTLGISPNSIPPRVP
TM3 85 105 PPYVHVFSLFNSHLXVGTCGV
TM4 132 152 ILFYGCIVYHGVYVPHFLXPV
TM5 186 207 IIFWVYTQXWDCXLIMVGVTFV
TM6 235 259 CGSHITTVPLFPGTVFVMYAQLGPV
TM7 265 284 GKAISIFYTLLIPTLNPLMY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage