Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10A3 Olfactory Receptor

Gene Symbol OR10A31 (View this gene in GeneCards)
Family 10
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases HSHTPCRX12, OR11-97, HsOR11.5.8, ORL45
External Ids HGNC: 8162   GeneBank: AB065768, AB065940, AF399634, AY284325-AY284356, BK004404, HSHTPRX12, NM_001003745   ORDB: ORL45   
Build #39 labels OR10A3
Chromosomal location 11:7,938,579-7,939,520 (-)
Cluster 11@8
Synteny CLIC#25
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10A6 85.3% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10A3 87% 314
Dog OR10A3E 87% 314
Chimp CONTIG674.107-3396 97% 314
Mouse Or10a3 83% 311
Mouse Or10a3b 81% 313
Rat Or10a3 83% 312
Rat Or10a3d 81% 313
Cow OR10AG63 51% 299

Expression evidences

Source Accession
ESTs FN165431
mRNA AB529269
GNF Atlas2 gnf1h05415_at
GNF Atlas2 gnf1h05416_s_at

Sequence information

Nucleotide sequence ATGAAAAGACAAAATCAAAGCTGTGTGGTTGAATTCATCCTCCTGGGCTTTTCTAACTTT
CCTGAGCTCCAGGTGCAGCTCTTTGGGGTTTTCCTAGTTATTTATGTGGTGACCCTGATG
GGAAATGCCATCATTACAGTCATCATCTCCTTAAACCAGAGCCTCCACGTTCCCATGTAC
CTGTTCCTCCTGAACCTATCTGTGGTGGAGGTGAGTTTCAGTGCAGTCATTACGCCTGAA
ATGCTGGTGGTGCTCTCTACTGAGAAAACTATGATTTCTTTTGTGGGCTGTTTTGCACAG
ATGTATTTCATCCTTCTTTTTGGTGGGACTGAATGTTTTCTCCTGGGAGCGATGGCTTAT
GACCGATTTGCTGCAATTTGCCATCCTCTGAACTACCCAGTGATTATGAACAGAGGGGTT
TTTATGAAATTAGTAATATTCTCATGGATCTCAGGGATCATGGTGGCTACTGTGCAGACC
ACTTGGGTATTTAGTTTTCCATTTTGTGGCCCCAATGAAATTAATCATCTCTTCTGTGAG
ACTCCCCCGGTACTAGAGCTTGTGTGTGCAGACACCTTCTTATTTGAAATCTATGCCTTC
ACAGGCACCATTTTGATTGTTATGGTTCCTTTCTTGTTGATCCTCTTGTCTTACATTCGA
GTTCTGTTTGCCATCCTGAAGATGCCATCAACTACTGGGAGACAAAAGGCCTTTTCCACC
TGTGCCTCTCACCTCACATCTGTGACCCTGTTCTATGGCACAGCCAATATGACTTATTTA
CAACCCAAATCTGGCTACTCACCCGAAACCAAGAAACTGATCTCATTGGCTTACACGTTG
CTTACCCCTCTGCTCAATCCGCTCATCTATAGCTTACGAAACAGTGAGATGAAGAGGACT
TTGATAAAACTATGGCGAAGAAAAGTGATTTTACACACATTC
Conceptual translation MKRQNQSCVVEFILLGFSNFPELQVQLFGVFLVIYVVTLMGNAIITVIISLNQSLHVPMY
LFLLNLSVVEVSFSAVITPEMLVVLSTEKTMISFVGCFAQMYFILLFGGTECFLLGAMAY
DRFAAICHPLNYPVIMNRGVFMKLVIFSWISGIMVATVQTTWVFSFPFCGPNEINHLFCE
TPPVLELVCADTFLFEIYAFTGTILIVMVPFLLILLSYIRVLFAILKMPSTTGRQKAFST
CASHLTSVTLFYGTANMTYLQPKSGYSPETKKLISLAYTLLTPLLNPLIYSLRNSEMKRT
LIKLWRRKVILHTF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C N/S 1000GP (YRI, YRI, YRI, YRI)
11 7,960,751 7,960,751 Del(1) -/A rs35194212 (DbSNP)
11 7,961,006 7,961,006 NS G/T P/H rs11606157 (DbSNP)
11 7,961,010 7,961,010 NS A/C F/V rs16934214 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N172S V163I Q159E Y132H F20V % Freq CORP
1 N V Q Y F 97.24 0.098
2 N V Q Y V 1.38 0.098
3 S V Q Y F 0.92 0.098
4 N V E Y F 0.23 0.098
5 N I Q Y F 0.15 0.098
6 N V Q H F 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10A3.aApr07-unspliced main_exon 3UTR chr11 7,938,576 7,938,579 -
CDS chr11 7,938,579 7,939,520 -