Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10A5 Olfactory Receptor

Gene Symbol OR10A51 (View this gene in GeneCards)
Family 10
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR11-403, OR11-85, HsOR11.4.4, ORL484
External Ids HGNC: 15131   GeneBank: AF324499, AF399623, BK004296, NM_178168   ORDB: ORL484   
Build #39 labels OR10A5, OR10A1
Chromosomal location 11:6,845,683-6,846,633 (+)
Cluster 11@7
Synteny CLIC#24
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10A2 95.71% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10A5 93% 316
Dog OR10A5F 93% 317
Dog OR10A5D 92% 317
Dog OR10A5E 91% 317
Chimp CONTIG*********** 99% 317
Chimp CONTIG784.10-247 95% 240
Mouse Or10a5 92% 316
Mouse Or10a2 89% 316
Rat Or10a5b 91% 316
Rat Or10a5 91% 316
Rat Or10a2 88% 316
Rat Or10a5c-ps 86% 316
Cow OR10U1 56% 301

Expression evidences

Source Accession
mRNA AF324499
GNF Atlas2 gnf1h07002_at

Sequence information

Nucleotide sequence ATGGCTATAGGAAACTGGACAGAAATAAGTGAATTTATCCTCATGAGCTTCTCTTCCCTA
CCTACTGAAATACAGTCATTGCTCTTCCTGACATTTCTAACTATCTATTTGGTTACTCTG
AAGGGAAACAGCCTCATCATTCTGGTTACCCTAGCTGACCCCATGCTACACAGCCCCATG
TACTTCTTCCTCAGAAACTTATCTTTCCTGGAGATTGGCTTCAACCTAGTCATTGTGCCC
AAAATGCTGGGGACCCTGCTTGCCCAGGACACAACCATCTCCTTCCTTGGCTGTGCCACT
CAGATGTATTTCTTCTTCTTCTTTGGGGTAGCTGAATGCTTCCTCCTGGCTACCATGGCA
TATGACCGCTATGTGGCCATCTGCAGTCCCTTGCACTACCCAGTCATCATGAACCAAAGG
ACACGGGCCAAACTGGCTGCTGCTTCCTGGTTCCCAGGCTTTCCTGTAGCTACTGTGCAG
ACCACATGGCTCTTCAGTTTTCCATTCTGTGGCACCAACAAGGTGAACCACTTCTTCTGT
GACAGCCCGCCTGTGCTGAAGCTGGTCTGTGCAGACACAGCACTGTTTGAGATCTACGCC
ATCGTCGGAACCATTCTGGTGGTCATGATCCCCTGCTTGCTGATCTTGTGTTCCTATACT
CGCATTGCTGCTGCTATCCTCAAGATCCCATCAGCTAAAGGGAAGCATAAAGCCTTCTCT
ACGTGCTCCTCACACCTCCTTGTTGTCTCTCTTTTCTATATATCTTCTAGCCTCACCTAC
TTCTGGCCTAAATCAAATAATTCTCCTGAGAGCAAGAAGTTGTTATCATTATCCTACACT
GTTGTGACTCCCATGTTGAACCCCATTATCTACAGCTTGAGAAATAGCGAGGTGAAGAAT
GCCCTCAGCAGGACCTTCCACAAGGTCCTAGCCCTCAGAAACTGTATCCCA
Conceptual translation MAIGNWTEISEFILMSFSSLPTEIQSLLFLTFLTIYLVTLKGNSLIILVTLADPMLHSPM
YFFLRNLSFLEIGFNLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMA
YDRYVAICSPLHYPVIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFC
DSPPVLKLVCADTALFEIYAIVGTILVVMIPCLLILCSYTRIAAAILKIPSAKGKHKAFS
TCSSHLLVVSLFYISSSLTYFWPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNSEVKN
ALSRTFHKVLALRNCIP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 6,867,035 6,867,035 NS A/T K/M rs7949377 (DbSNP)
11 6,867,199 6,867,199 NS C/T L/F rs7934823 (DbSNP)
11 6,867,635 6,867,635 NS C/T T/M rs60000441 (DbSNP)
11 6,867,510 6,867,510 SYN C/T Y/Y rs56403411 (DbSNP)
11 6,867,015 6,867,015 SYN C/T T/T rs7952340 (DbSNP)
11 100 -100 SYN T/C T/T 1000GP (YRI)
11 100 -100 NS A/T K/M 1000GP (YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

F29S K41M L96F R142W P230L A232G T241M Y253C W262R V282M % Freq CORP
1 F K L R P A T Y W V 93.39 0.116
2 F K L R P A M Y W V 1.54 0.327
3 F K F R P A T Y W V 1.46 0.116
4 F K L R L A T Y W V 1.46 0.116
5 F M L R P A T Y W V 0.77 0.116
6 F K L R P A T C W V 0.61 0.034
7 S M L R P A T Y W V 0.38 0.116
8 F M L W P G T Y R M 0.38 0.116

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10A5.aApr07-unspliced main_exon 5UTR chr11 6,845,652 6,845,683 +
CDS chr11 6,845,683 6,846,633 +
3UTR chr11 6,846,633 6,846,705 +