Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10A7 Olfactory Receptor

Gene Symbol OR10A71 (View this gene in GeneCards)
Family 10
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR12-6, HsOR12.5.5, ORL3655
External Ids HGNC: 15329   GeneBank: AB065864, AF399626, BK004327, NM_001005280   ORDB: ORL3655   
Build #39 labels OR10A7
Chromosomal location 12:55,221,025-55,221,972 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10A2 61.22% 294
OR10A4 61.76% 306
OR10A5 61.41% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10A7 93% 316
Chimp CONTIG*********** 97% 296
Mouse Or10a4 63% 315
Rat Or10a4 63% 316
Cow OR10AG63 55% 299

Expression evidences

Source Accession
mRNA AB529271
GNF Atlas2 gnf1h10668_at

Sequence information

Nucleotide sequence ATGATCTGTGAAAATCACACCAGAGTCACTGAATTTATTCTTCTTGGTTTTACAAACAAC
CCCGAGATGCAAGTTTCCCTCTTTATTTTTTTCCTGGCCATTTATACAGTCACTTTGTTG
GGCAACTTTCTTATTGTCACAGTTACCAGTGTGGATCTCGCACTTCAAACACCCATGTAC
TTCTTTCTTCAAAATCTGTCACTTCTTGAAGTATGTTTCACCTTGGTTATGGTGCCAAAA
ATGCTTGTAGATCTAGTGTCCCCAAGGAAAATTATCTCTTTTGTGGGCTGTGGTACCCAG
ATGTACTTCTTCTTCTTCTTTGGCAGTTCTGAATGTTTCCTTCTCTCCATGATGGCTTAT
GATCGCTTTGTGGCCATCTGTAACCCTCTCCATTATTCAGTCATAATGAACAGGTCCCTA
TGCTTGTGGATGGCCATAGGCTCTTGGATGTCCGGTGTTCCTGTGTCTATGCTACAGACA
GCTTGGATGATGGCCCTTCCTTTCTGTGGACCAAATGCCGTGGACCACTTTTTCTGTGAT
GGTCCCCCAGTGTTAAAACTAGTCACAGTGGATACAACCATGTATGAAATGCAAGCACTT
GCCTCCACACTCCTGTTTATCATGTTTCCCTTTTGTCTCATTTTGGTTTCCTACACCCGC
ATTATCATAACAATTCTGAGGATGTCCTCTGCCACTGGCCGCCAGAAGGCATTTTCTACT
TGTTCCTCACACCTCATTGTGGTGTCCCTCTTCTACGGAACAGCCAGTCTGACCTACCTG
CGGCCCAAATCAAACCAGTCCCCTGAGAGCAAGAAGCTAGTGTCATTGTCCTACACTGTC
ATCACACCTATGCTAAACCCCATCATCTACGGCCTGAGGAACAATGAAGTGAAAGGGGCT
GTCAAGAGGACAATCACTCAAAAAGTCTTACAGAAGTTAGATGTGTTT
Conceptual translation MICENHTRVTEFILLGFTNNPEMQVSLFIFFLAIYTVTLLGNFLIVTVTSVDLALQTPMY
FFLQNLSLLEVCFTLVMVPKMLVDLVSPRKIISFVGCGTQMYFFFFFGSSECFLLSMMAY
DRFVAICNPLHYSVIMNRSLCLWMAIGSWMSGVPVSMLQTAWMMALPFCGPNAVDHFFCD
GPPVLKLVTVDTTMYEMQALASTLLFIMFPFCLILVSYTRIIITILRMSSATGRQKAFST
CSSHLIVVSLFYGTASLTYLRPKSNQSPESKKLVSLSYTVITPMLNPIIYGLRNNEVKGA
VKRTITQKVLQKLDVF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 NS T/C L/P 1000GP (YRI, YRI)
12 55,221,310 55,221,310 NS G/A G/S 1000GP (CHBJPT)
12 55,221,543 55,221,543 SYN C/T A/A 1000GP (CEU)
12 55,615,094 55,615,094 NS A/G S/G rs12578318 (DbSNP)
12 55,615,703 55,615,702 Ins(1) -/G rs34372866 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S50N D52E L53P L66V G96S F106L C141R K272Q G291S % Freq CORP
1 S D L L G F C K G 97.54 0.081
2 S D L L S F C K G 1.00 0.081
3 S D L L G F R K G 0.54 0.081
4 S D P V G L C K S 0.46 0.418
5 N D L L G F C K G 0.15 0.081
6 S E L L G F C K G 0.15 0.081
7 S D L L G F C Q G 0.08 0.081
8 S D P L G L C K S 0.08 0.081

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10A7.aApr07-unspliced main_exon CDS chr12 55,221,025 55,221,972 +
3UTR chr12 55,221,972 55,221,975 +