Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10AA1P Olfactory Receptor

Gene Symbol OR10AA1P1 (View this gene in GeneCards)
Family 10
Subfamily AA
Pseudogene Yes
CORP pseudogene probability score
Aliases OR1-24, HsOR1.4.19P, ORL3068
External Ids HGNC: 14989   GeneBank: AB065447, BK004531, NG_004278   ORDB: ORL3068   
Build #39 labels OR10AA1P
Chromosomal location 1:158,808,402-158,809,335 (-)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10C1 47.28% 294
OR6N1 46.15% 299
OR6N2 42.72% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10AA2 73% 303
Mouse Or10aa1 84% 303
Rat Or10aa1 83% 303
Cow OR10AA1 82% 303
Cow OR10AA1C 80% 303
Orang OR10AA1 93% 299
Horse OR10AA1 82% 303
Chimp OR6N1 46% 305

Expression evidences

Source Accession
GNF Atlas2 gnf1h10877_at

Sequence information

Nucleotide sequence ATGGATCACGTCAGTCATAACTGGACTCAGAGTTTTATCCTTGCTGGTTTCACCACCACT
GGGACCCTACAACCTCTTGCCTTCTTGGGGACCCTATGCATCTATCTCCTCACACTTGCA
GGGAACATTCTCATCATTGTCCTGGTACAGTTAGATTCTGGACTGTTCACGCCCATGTAC
TTATTTATCAGTGTCCTCTCCTTTGTAGAGGTGTGGTATGTCAGCACCACAGTGCCCATG
CTGCTGCACACCTTGCTCCAAGGGTGTTCACCCGTCTCATCAGCTGTATGCTTTATTCAG
CTATGTCTTTCATTCCTTAGGGATGACTGAGTGCTACCTGCTGGGTGTCATGGCACTGGA
TAGCTACCTTATCATCTGCCACCCACTCCACTACCACGCACTCATGAGCAGACAGGTACA
GTTACGACTAGCTGGGGCCAGTTGGGTGGCTGGCTTCTCAGCTGCACTTGTGCCAGCCAC
CCTCACTGCCACTCTGCCCTTCTGCTTGAAAGAGGTGGCCCATTACTTTTGTGACTTGGC
ACCACTAATGCGGTTGGCATGTGTGGACACAAGCTGGCATGCTAGGGCCCATGGCACAGT
GATTGGTGTGGCCACTGGTTGCAACTTTGTGCTCATTTTGGGACTCTATGGAGGTATCCT
GAATGCTGTGCTGAAGCTACCCTCAGCTGCCAGTAGTGCCAAGGCCTTCTCTACCTGTTC
CTCCCACGTAACTGTGGTGGCACTATTCTATGCTTCTGCCTTCACAGTATATGTGGGCTC
ACCTGGGAGTCGACCTGAGAGCACAGACAAGCTTGTTGCCTTGGTTTATGCCCTTATTAC
CCCTTTCCTCAATCCTATCATCTATAGCCTTCGCAACAAGGAGGTGAAGAAGGCTTTAAG
GAGAGTCATGGCTGGGCGCGGTGGCTCACGCCTG
Conceptual translation MDHVSHNWTQSFILAGFTTTGTLQPLAFLGTLCIYLLTLAGNILIIVLVQLDSGLFTPMY
LFISVLSFVEVWYVSTTVPMLLHTLLQGCSPVSSAVCFIQL\FHSLGMTECYLLGVMAL
DSYLIICHPLHYHALMSRQVQLRLAGASWVAGFSAALVPATLTATLPFCLKEVAHYFCDL
APLMRLACVDTSWHARAHGTVIGVATGCNFVLILGLYGGILNAVLKLPSAASSAKAFSTC
SSHVTVVALFYASAFTVYVGSPGSRPESTDKLVALVYALITPFLNPIIYSLRNKEVKKAL
RRVMAGRGGSRL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
1 158,778,206 158,778,206 SNP C/T rs66499917 (DbSNP)
1 158,778,399 158,778,399 SNP G/A rs61755195 (DbSNP)
1 158,778,582 158,778,582 SNP C/T rs6694926 (DbSNP)
1 158,778,764 158,778,764 SNP G/T rs7550055 (DbSNP)
1 158,778,853 158,778,853 SNP C/G rs61746906 (DbSNP)
1 158,779,041 158,779,041 SNP A/G rs16841119 (DbSNP)
1 158,808,851 158,808,851 SNP T/G 1000GP (CEU)
1 158,808,974 158,808,974 SNP T/G 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.