Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10AD1 Olfactory Receptor

Gene Symbol OR10AD11 (View this gene in GeneCards)
Family 10
Subfamily AD
Pseudogene No
CORP pseudogene probability score 0.61 (pseudogene)
Aliases OR12-1, HsOR12.3.1
External Ids HGNC: 14819   GeneBank: AB065872, AF399474, BK004354, NM_001004134   
Build #39 labels OR10AD1
Chromosomal location 12:48,202,342-48,203,292 (-)
Cluster 12@49a
Synteny CLIC#30
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10A4 46.13% 310
OR2D3 43.28% 305
OR5V1 44.44% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10AD1P 86% 311
Dog OR10AD1CP 84% 316
Dog OR10AD1B 84% 316
Chimp CONTIG*********** 95% 315
Mouse Or5v1b 44% 307
Rat Or10ad1-ps 81% 301
Cow OR10AD1P 83% 316
Cow OR10AD1CP 82% 314
Cow OR10AD1DP 83% 316

Expression evidences

Source Accession
ESTs DB338028
mRNA AB587540
GNF Atlas2 gnf1h07571_at

Sequence information

Nucleotide sequence ATGCTAAGGAATGGCAGCATAGTGACGGAATTTATCCTCGTGGGCTTTCAGCAGAGCTCC
ACTTCCACACGAGCATTGCTCTTTGCCCTCTTCTTGGCCCTCTACAGCCTCACCATGGCC
ATGAATGGCCTCATCATCTTTATCACCTCCTGGACAGACCCCAAGCTCAACAGCCCCATG
TACTTCTTCCTCGGCCATCTGTCTCTCCTGGATGTCTGCTTCATCACCACTACCATCCCA
CAGATGTTGATCCACCTCGTGGTCAGGGACCACATTGTCTCCTTTGTATGTTGCATGACC
CAGATGTACTTTGTCTTCTGTGTTGGTGTGGCCGAGTGCATCCTCTTGGCTTTCATGGCC
TATGACCGTTATGTTGCTATCTGCTACCCACTTAACTATGTCCCGATCATAAGCCAGAAG
GTCTGTGTCAGGCTTGTGGGAACTGCCTGGTTCTTTGGGCTGATCAATGGCATCTTTCTC
GAGTATATTTCATTCCGAGAGCCCTTCCGCAGAGACAACCACATAGAAAGCTTCTTCTGT
GAGGCCCCCATAGTGATTGGCCTCTCTTGTGGGGACCCTCAGTTTAGTCTGTGGGCAATC
TTTGCCGATGCCATCGTGGTAATTCTCAGCCCCATGGTGCTCACTGTCACTTCCTATGTG
CACATCCTGGCCACCATCCTCAGCAAAGCCTCCTCCTCAGGTCGGGGGAAGACTTTCTCT
ACTTGTGCCTCTCACCTGACTGTGGTCATCTTTCTCTACACTTCAGCTATGTTCTCTTAC
ATGAACCCCCACAGCACACATGGGCCTGACAAAGACAAACCTTTCTCCCTCCTGTACACC
ATCATTACCCCCATGTGCAACCCCATCATTTATAGTTTCCGCAACAAGGAAATTAAGGAG
GCCATGGTGAGGGCACTTGGAAGAACCAGGCTGGCCCAGCCACAGTCTGTC
Conceptual translation MLRNGSIVTEFILVGFQQSSTSTRALLFALFLALYSLTMAMNGLIIFITSWTDPKLNSPM
YFFLGHLSLLDVCFITTTIPQMLIHLVVRDHIVSFVCCMTQMYFVFCVGVAECILLAFMA
YDRYVAICYPLNYVPIISQKVCVRLVGTAWFFGLINGIFLEYISFREPFRRDNHIESFFC
EAPIVIGLSCGDPQFSLWAIFADAIVVILSPMVLTVTSYVHILATILSKASSSGRGKTFS
TCASHLTVVIFLYTSAMFSYMNPHSTHGPDKDKPFSLLYTIITPMCNPIIYSFRNKEIKE
AMVRALGRTRLAQPQSV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 48,596,877 48,596,876 Ins(1) -/A rs58864350 (DbSNP)
12 48,596,878 48,596,877 Ins(1) -/A rs67974295 (DbSNP)
12 48,597,053 48,597,053 NS A/G V/A rs17122812 (DbSNP)
12 48,596,241 48,596,241 NS A/G Y/H rs11168459 (DbSNP)
12 48,596,772 48,596,772 NS A/T L/M rs12818189 (DbSNP)
12 48,596,771 48,596,771 NS A/T M/K rs12816566 (DbSNP)
12 48,596,579 48,596,579 NS C/T R/Q rs17224674 (DbSNP)
12 48,596,254 48,596,254 SYN A/C P/P rs11830378 (DbSNP)
12 48,596,890 48,596,890 SYN A/G F/F rs17823193 (DbSNP)
12 48,597,064 48,597,064 SYN A/G N/N rs17224828 (DbSNP)
12 48,597,049 48,597,049 SYN C/T T/T rs17122809 (DbSNP)
12 48,203,270 48,203,270 NS A/G V/A 1000GP (CEU, CHBJPT)
12 48,203,107 48,203,107 SYN G/A F/F 1000GP (CEU)
12 48,202,458 48,202,458 NS A/G Y/H 1000GP (CEU, CHBJPT)
12 48,202,858 48,202,858 SYN A/G L/L 1000GP (CEU)
12 48,203,281 48,203,281 SYN A/G N/N 1000GP (CEU)
12 48,202,763 48,202,763 NS C/T S/N 1000GP (CEU)
12 48,202,471 48,202,471 SYN A/C P/P 1000GP (CEU)
12 48,202,589 48,202,589 NS C/T R/Q 1000GP (CEU)
12 48,202,796 48,202,796 NS C/T R/Q 1000GP (CEU)
12 48,202,701 48,202,701 NS A/T W/R 1000GP (CEU)
12 48,203,266 48,203,266 SYN C/T T/T 1000GP (CEU)
12 100 -100 NS A/G Y/H 1000GP (YRI, YRI, YRI)
12 100 -100 SYN C/T T/T 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
12 48,547,128 48,779,562 CopyNumber Variation_2983 (DGV)
12 48,429,702 48,825,499 CopyNumber Variation_3888 (DGV)
12 48,565,643 48,645,561 CopyNumber Variation_6987 (DGV)
12 48,541,757 48,779,562 CopyNumber Variation_8729 (DGV)
12 48,537,505 48,758,024 CopyNumber Variation_30600 (DGV)
CopyNumber 105 (Hasin)
12 48,594,125 48,597,175 CopyNumber #85 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Y279H W198R S177N R170C R166Q R123H F104S V8A % Freq CORP
1 Y W S R R R F V 72.58 0.654
2 H W S R R R F A 16.67 0.654
3 Y R N R Q R F V 3.38 0.654
4 H W S R R R F V 2.53 0.654
5 H W S R R H F V 2.38 0.971
6 Y R N R R R F V 1.61 0.654
7 Y W S R R R S V 0.54 0.654
8 Y W S C R R F V 0.15 0.654
9 H W S C R R F V 0.15 0.654

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10AD1.aApr07 main_exon 3UTR chr12 48,202,027 48,202,342 -
CDS_partial chr12 48,202,342 48,202,549 -
exon_5UTR chr12 48,233,569 48,233,776 -
exon_5UTR chr12 48,278,427 48,278,634 -
exon_5UTR chr12 48,284,150 48,284,209 -
OR10AD1.bApr07-unspliced main_exon 3UTR chr12 48,202,083 48,202,342 -
CDS chr12 48,202,342 48,203,292 -
5UTR chr12 48,203,292 48,203,459 -