Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10AG1 Olfactory Receptor

Gene Symbol OR10AG11 (View this gene in GeneCards)
Family 10
Subfamily AG
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR11-160, HsOR11.11.37
External Ids HGNC: 19607   GeneBank: AB065594, BK004519, NM_001005491   
Build #39 labels OR10AG1
Chromosomal location 11:55,967,561-55,968,463 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10A7 47.81% 297
OR10C1 48.15% 297
OR10R3P 46.8% 297

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10AG1 80% 300
Chimp CONTIG970.37-449 97% 300
Mouse Or10ag2 75% 300
Rat Or10ag2 74% 300
Cow OR10AG1 73% 301

Expression evidences

Source Accession
mRNA AB529272
GNF Atlas2 gnf1h05460_at

Sequence information

Nucleotide sequence ATGGAATTTGTTCTTTTGGGGTTTTCTGATATTCCCAATCTCCACTGGATGCTTTTTAGT
ATATTTTTACTTATGTATTTGATGATCCTGATGTGCAATGGCATCATAATACTACTAATA
AAAATTCACCCCGCTCTCCAGACTCCCATGTATTTTTTTCTTAGCAATTTTTCCCTTTTG
GAAATCTGTTATGTAACAATCATTATCCCAAGAATGCTCATGGACATTTGGACTCAGAAA
GGAAATATTTCTTTGTTTGCTTGTGCTACACAAATGTGTTTTTTTCTTATGCTTGGAGGC
ACGGAGTGTCTCCTTCTGACAGTGATGGCCTATGACCGCTACGTGGCTATTTGTAAGCCT
TTGCAGTATCCTCTAGTGATGAACCACAAAGTCTGCATTCAGCTGATAATAGCTTCCTGG
ACCATCACAATTCCTGTAGTAATTGGGGAAACATGCCAAATTTTCCTTTTGCCCTTTTGC
GGAACTAACACAATTAATCATTTCTTTTGTGACATCCCGCCAATACTCAAGCTTGCTTGT
GGAAACATATTTGTGAATGAGATAACAGTCCATGTAGTAGCGGTGGTGTTTATCACGGTG
CCATTTCTGTTGATTGTTGTCTCTTATGGCAAAATTATCTCCAACATTTTGAAATTGTCA
TCAGCCAGAGGAAAGGCTAAAGCCTTCTCCACCTGCTCATCTCACCTAATAGTTGTAATC
TTATTCTTTGGAGCAGGTACTATCACTTATTTACAGCCCAAACCACATCAGTTTCAAAGG
ATGGGGAAACTGATTTCTCTTTTCTACACCATTCTGATTCCAACTTTGAATCCTATTATA
TATACCCTGAGGAACAAAGATATCATGGTGGCATTGAGAAAATTACTAGCTAAGTTATTA
ACA
Conceptual translation MEFVLLGFSDIPNLHWMLFSIFLLMYLMILMCNGIIILLIKIHPALQTPMYFFLSNFSLL
EICYVTIIIPRMLMDIWTQKGNISLFACATQMCFFLMLGGTECLLLTVMAYDRYVAICKP
LQYPLVMNHKVCIQLIIASWTITIPVVIGETCQIFLLPFCGTNTINHFFCDIPPILKLAC
GNIFVNEITVHVVAVVFITVPFLLIVVSYGKIISNILKLSSARGKAKAFSTCSSHLIVVI
LFFGAGTITYLQPKPHQFQRMGKLISLFYTILIPTLNPIIYTLRNKDIMVALRKLLAKLL
T

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,735,649 55,735,649 NS A/C I/M rs61896167 (DbSNP)
11 55,735,518 55,735,518 NS A/G I/T rs61896165 (DbSNP)
11 55,735,579 55,735,579 SYN A/G L/L rs61896166 (DbSNP)
11 55,735,106 55,735,106 SYN A/G P/P rs61896163 (DbSNP)
11 55,735,280 55,735,280 SYN A/T S/S rs61896164 (DbSNP)
11 55,735,091 55,735,091 SYN C/T L/L rs12292026 (DbSNP)
11 55,968,337 55,968,337 NS G/C H/D 1000GP (CEU)
11 55,967,797 55,967,797 NS T/C R/G 1000GP (CEU)
11 55,968,173 55,968,173 NS C/A M/I 1000GP (CEU)
11 55,968,042 55,968,042 NS G/A T/I 1000GP (CEU)
11 55,968,103 55,968,103 SYN A/G L/L 1000GP (CEU)
11 55,967,937 55,967,937 NS A/G L/P 1000GP (CEU)
11 55,967,630 55,967,630 SYN A/G P/P 1000GP (CEU)
11 55,968,332 55,968,332 SYN G/A P/P 1000GP (CEU)
11 55,967,804 55,967,804 SYN T/A S/S 1000GP (CEU)
11 55,968,372 55,968,372 NS A/G M/T 1000GP (CEU)
11 55,968,381 55,968,381 NS A/G M/T 1000GP (CEU)
11 55,967,872 55,967,872 NS T/A I/F 1000GP (CHBJPT)
11 100 -100 SYN C/T L/L 1000GP (YRI, YRI, YRI)
11 100 -100 NS G/A T/I 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,710,709 55,787,839 CopyNumber Variation_1245 (DGV)
11 55,689,863 55,849,156 CopyNumber Variation_2927 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,685,799 55,842,512 CopyNumber Variation_9189 (DGV)
11 55,685,556 55,819,544 CopyNumber Variation_29912 (DGV), Variation_48846 (DGV)
11 55,685,556 55,796,170 CopyNumber Variation_48845 (DGV)
11 55,685,556 55,836,620 CopyNumber Variation_48847 (DGV)
11 55,683,109 55,833,490 CopyNumber Variation_85786 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V239A V192I L176P T141I M97I H43D M31T M28T % Freq CORP
1 V V L T M H M M 94.09 0.078
2 V V L I I D T T 3.92 0.078
3 A V L T M H M M 0.54 0.135
4 V V L I I H M M 0.54 0.078
5 V I L T M H M M 0.46 0.078
6 V V L I I H T T 0.15 0.078
7 V V P I I D M T 0.08 0.078
8 V V L I I D M M 0.08 0.078
9 V V L T I D T T 0.08 0.078
10 V V L T M D T T 0.08 0.078

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10AG1.aApr07-unspliced main_exon 3UTR chr11 55,967,558 55,967,561 -
CDS chr11 55,967,561 55,968,463 -