Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10D3 Olfactory Receptor

Gene Symbol OR10D31 (View this gene in GeneCards)
Family 10
Subfamily D
Pseudogene No
CORP pseudogene probability score
Aliases OR11-295, HSHTPCRX09, OR11-293, HsOR11.18.19
External Ids HGNC: 8168   
Build #39 labels
Chromosomal location 11:124,185,270-124,186,205 (+)
Cluster 11@124
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10D3 91% 312
Mouse Or10d3 89% 312
Rat Or10d3 88% 311
Cow OR10D3 88% 308

Expression evidences

Source Accession
ESTs EG357672
mRNA AB529246

Sequence information

Nucleotide sequence ATGGAGGTGAAGAACTGCTGCATGGTGACAGAGTTCATCCTTTTGGGAATCCCACACACA
GAGGGGCTGGAGATGACACTTTTGTCTTATTCTTGCCCTTCTATGCCTGCACTCTACTGG
GAAATGTGTCTATCCTTGTTGCTGTTATGTCTTCTGCTCGCCTTCACACACCTATGTATT
TCTTCCTGGGAAACTTGTCTGTGTTTGACATGGGTTTCTCCTCAGTGACTTGTCCCAAAA
TGCTGCTCTACCTTATGGGGCTGAGCCGACTCATCTCCTACAAAGACTGTGTCTGCCAGC
TTTTCTTCTTCCATTTCCTCGGGAGCATTGAGTGCTTCTTGTTTACGGTGATGGCCTATG
ACCGCTTCACTGCCATCTGTTATCCTCTGCGATACACAGTCATCATGAACCCAAGGATCT
GTGTGGCCCTGGCTGTGGGCACATGGCTGTTAGGGTGCATTCATTCCAGTATCTTGACCT
CCCTCACCTTCACCTTGCCATACTGTGGTCCCAATGAAGTGGATCACTTCTTCTGTGACA
TTCCAGCACTGTTGCCCTTGGCCTGTGCTGACACATCCTTAGCCCAGAGGGTGAGCTTCA
CCAACGTTGGCCTCATATCTCTTGTCTGCTTTCTGCTAATTCTTTTATCCTACACTAGAA
TCACAATATCTATCTTAAGCATTCGTACAACTGAGGGCCGTCGCCGTGCCTTCTCCACCT
GCAGTGCTCACCTCATTGCCATCCTCTGTGCCTATGGGCCCATCATCACTGTCTACCTGC
AGCCCACACCCAACCCCATGCTGGGAACCGTGGTACAAATTCTCATGAATCTGGTAGGAC
CAATGCTGAACCCTTTGATCTATACCTTGAGGAATAAGGAAGTAAAAACAGCCCTGAAAA
CAATATTGCACAGGACAGGCCATGTTCCTGAGAGT
Conceptual translation MEVKNCCMVTEFILLGIPHTEGLEM/LFVLFLPFYACTLLGNVSILVAVMSSARLHTPM
YFFLGNLSVFDMGFSSVTCPKMLLYLMGLSRLISYKDCVCQLFFFHFLGSIECFLFTVMA
YDRFTAICYPLRYTVIMNPRICVALAVGTWLLGCIHSSILTSLTFTLPYCGPNEVDHFFC
DIPALLPLACADTSLAQRVSFTNVGLISLVCFLLILLSYTRITISILSIRTTEGRRRAFS
TCSAHLIAILCAYGPIITVYLQPTPNPMLGTVVQILMNLVGPMLNPLIYTLRNKEVKTAL
KTILHRTGHVPES

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 124,056,088 124,056,088 SNP A/G rs61907117 (DbSNP)
11 124,056,257 124,056,257 SNP A/G rs61746122 (DbSNP)
11 124,056,377 124,056,377 SNP T/C rs2512228 (DbSNP)
11 124,056,450 124,056,450 SNP C/G rs61743734 (DbSNP)
11 124,056,453 124,056,453 SNP C/G rs7937661 (DbSNP)
11 124,056,566 124,056,566 SNP A/G rs7937809 (DbSNP)
11 124,056,581 124,056,581 SNP G/A rs2466584 (DbSNP)
11 124,056,582 124,056,582 SNP C/T rs7937603 (DbSNP)
11 124,056,732 124,056,732 SNP T/G rs2512227 (DbSNP)
11 124,056,787 124,056,787 SNP G/A rs2512226 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T38A Y94C V134A I158M L159F R197K N202S Y252* V271M % Freq CORP
1 T Y V I L R N Y V 46.47 0.177
2 T Y A I L K N * M 35.18 1.200
3 T Y A I L R S * M 12.90 1.200
4 T C V M L R N Y V 1.54 0.177
5 T Y A I F K N * M 1.46 1.200
6 A Y V I L R N Y V 0.77 0.177
7 T Y A I F K N Y M 0.38 0.177
8 T Y A I L R N * M 0.38 1.200
9 T Y V I L R N Y M 0.31 0.177
10 T Y V M L R N Y V 0.23 0.177
11 T Y V I L R S Y V 0.08 0.177
12 T Y V I L R S * M 0.08 1.200
13 T Y A I F R N * M 0.08 1.200
14 T Y V I L K N Y V 0.08 0.177
15 T Y V I L R N * M 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10D3P.aApr07-unspliced main_exon 5UTR chr11 124,185,243 124,185,270 +
CDS chr11 124,185,270 124,186,205 +
3UTR chr11 124,186,205 124,186,245 +