Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10G2 Olfactory Receptor

Gene Symbol OR10G21 (View this gene in GeneCards)
Family 10
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.23 (functional)
Aliases OR14-41, AE000658-B, HsOR14.2.4, ORL3697
External Ids HGNC: 8170   GeneBank: AB065894, BK004670, NM_001005466   ORDB: ORL3697   
Build #39 labels OR10G2
Chromosomal location 14:21,633,913-21,634,842 (-)
Cluster 14@22b
Synteny CLIC#35
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10G1P 93.87% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10G6 62% 295
Chimp CONTIG1000.47-2506 95% 310
Mouse Or10g1 90% 310
Mouse Or10g1b 88% 310
Rat Or10g1 88% 310
Rat Or10g1b 87% 310
Cow OR10G1 91% 310
Cow OR10G1C 89% 310

Expression evidences

Source Accession
mRNA AB529274
GNF Atlas2 gnf1h11245_at

Sequence information

Nucleotide sequence ATGGGAAAGACCAAAAACACATCGCTGGATGCCGTGGTGACAGATTTCATTCTTCTGGGT
TTGTCTCACCCCCCAAATCTAAGAAGCCTCCTCTTCCTGGTCTTCTTCATCATTTACATC
CTCACTCAGCTGGGGAACCTGCTCATTCTGCTCACCATGTGGGCTGACCCGAAGCTCTGT
GCTCGCCCCATGTACATTCTTCTGGGAGTGCTCTCATTCCTGGACATGTGGCTCTCCTCA
GTCACCGTTCCTCGGCTTATTTTGGATTTTACTCCTTCCATCAAGGCTATCCCGTTTGGT
GGCTGTGTGGCTCAACTGTATTTCTTTCACTTCCTGGGCAGCACCCAGTGCTTCCTCTAC
ACCTTGATGGCCTATGACAGGTACCTAGCAATATGTCAGCCCCTGCACTACCCAGTGCTC
ATGAATGGGAGGTTATGCACAGTCCTTGTGGCTGGAGCTTGGGTCGCCGGCTCCATGCAT
GGGTCTATCCAGGCCACCTTGACCTTCCGCCTGCCCTACTGTGGGCCCAATCAGGTGGAT
TACTTTATCTGTGACATCCGCGCAGTATTGAGACTGGCCTGTGCTGACACAACTGTCAAT
GAGCTTGTGACCTTTGTGGACGTCAGGGTAGTGGCCGCCAGTTGCTTCATGTTAATTCTG
CTCTCCTATGCCAACATAGTCCATGCCATCCTGAAGATACGCACCGCTGATGGGAGGCGC
CGGGCCTTCTCCACCTGTGGCTCCCACCTAATCGTGGTCACAGTCTACTATGTCCCCTGT
ATTTTCATCTACCTTAGGGCTGGCTCCAAAGACCCCCTGGATGGGGCAGCGGCTGTGTTT
TACACTGTTGTCACTCCATTACTGAACCCCCTCATCTATACACTGAGGAACCAGGAAGTG
AAGTCTGCCCTGAAGAGGATAACAGCAGGT
Conceptual translation MGKTKNTSLDAVVTDFILLGLSHPPNLRSLLFLVFFIIYILTQLGNLLILLTMWADPKLC
ARPMYILLGVLSFLDMWLSSVTVPRLILDFTPSIKAIPFGGCVAQLYFFHFLGSTQCFLY
TLMAYDRYLAICQPLHYPVLMNGRLCTVLVAGAWVAGSMHGSIQATLTFRLPYCGPNQVD
YFICDIRAVLRLACADTTVNELVTFVDVRVVAASCFMLILLSYANIVHAILKIRTADGRR
RAFSTCGSHLIVVTVYYVPCIFIYLRAGSKDPLDGAAAVFYTVVTPLLNPLIYTLRNQEV
KSALKRITAG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 NS C/G R/P 1000GP (YRI, YRI, YRI)
14 100 -100 SYN A/G H/H 1000GP (YRI, YRI)
14 21,634,137 21,634,137 NS C/T A/T 1000GP (CEU)
14 21,634,161 21,634,161 NS G/T H/N 1000GP (CEU)
14 21,634,162 21,634,162 SYN G/T V/V 1000GP (CEU)
14 21,634,177 21,634,177 SYN G/C S/S 1000GP (CEU)
14 21,634,283 21,634,283 NS C/G R/P 1000GP (CEU)
14 21,634,436 21,634,436 NS T/C H/R 1000GP (CEU, CHBJPT)
14 21,634,456 21,634,456 SYN T/C L/L 1000GP (CEU, CHBJPT)
14 21,634,589 21,634,589 NS C/A R/L 1000GP (CEU, CHBJPT)
14 22,102,169 22,102,169 NS A/G V/A rs28445447 (DbSNP)
14 22,102,293 22,102,293 NS C/T A/T rs41307110 (DbSNP)
14 22,102,315 22,102,315 SYN G/A H/H rs61753931 (DbSNP)
14 22,102,333 22,102,333 SYN C/G S/S rs41317324 (DbSNP)
14 22,102,374 22,102,374 NS C/T G/R rs12894405 (DbSNP)
14 22,102,414 22,102,414 SYN A/T A/A rs10136017 (DbSNP)
14 22,102,439 22,102,439 NS C/G R/P rs35963889 (DbSNP)
14 22,102,592 22,102,592 NS C/T R/H rs10138694 (DbSNP)
14 22,102,612 22,102,612 SYN C/T L/L rs10138704 (DbSNP)
14 22,102,745 22,102,745 NS A/C L/R rs41314525 (DbSNP)
14 22,102,800 22,102,800 NS A/G F/L rs10146821 (DbSNP)
14 22,102,829 22,102,829 NS A/G L/P rs57476477 (DbSNP)
14 22,102,871 22,102,871 NS T/C Q/R rs61754893 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 21,931,624 22,169,502 CopyNumber Variation_5318 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A236T R209G R187P H136R P98L R85L L67F P57L M53V Q43R K5N % Freq CORP
1 A R R H P R L P M Q K 53.99 0.139
2 A G P R P L L P M Q K 6.84 0.139
3 A G P H P R L P M Q K 5.84 0.139
4 A G P H P L L P M Q K 5.30 0.139
5 A G P R P R L P M Q K 4.84 0.139
6 A G R R P R F P M Q K 4.07 0.139
7 A G R H P R F P M Q K 3.00 0.139
8 A R R H P L L P M Q K 2.38 0.139
9 T G P R P L L P M Q K 2.15 0.139
10 T G P H P L L P M Q K 2.00 0.139
11 A G R R P R L P M Q K 1.23 0.139
12 A G R H P R L P M Q K 1.15 0.139
13 A R P H P L L P M Q K 1.00 0.139
14 A R R R P L L P M Q K 1.00 0.139
15 A R R H P R F P M Q K 0.84 0.139
16 A R R H P R L P M R K 0.69 0.139
17 A G R R P L L P M Q K 0.54 0.139
18 T R R H P L L P M Q K 0.46 0.139
19 A G R H P L L P M Q K 0.38 0.139
20 A G P R P L L P V Q K 0.31 0.139
21 A R P H P R L P M Q K 0.23 0.139
22 T R P H P L L P M Q K 0.23 0.139
23 A G P R P R L L M Q K 0.23 0.139
24 T G P R P R L P M Q K 0.15 0.139
25 A G P H P L L P V Q K 0.15 0.139
26 T R R R P L L P M Q K 0.15 0.139
27 A R R R P R F P M Q K 0.15 0.139
28 A R R R P R L L M Q K 0.08 0.139
29 A R P R P L L P M Q K 0.08 0.139
30 A R P H P R F P M Q K 0.08 0.139
31 T G R R P L L P M Q K 0.08 0.139
32 A G P R L R L P M Q K 0.08 0.139
33 A R R H P R L P M Q N 0.08 0.139
34 T G R H P L L P M Q K 0.08 0.139
35 A G R R P L L P V Q K 0.08 0.139
36 A R R R P R L P M Q K 0.08 0.139

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10G2.aApr07-unspliced main_exon 3UTR chr14 21,633,910 21,633,913 -
CDS chr14 21,633,913 21,634,842 -