Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10G3 Olfactory Receptor

Gene Symbol OR10G31 (View this gene in GeneCards)
Family 10
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases AE000658-D, OR14-40, HsOR14.2.2, ORL3695
External Ids HGNC: 8171   GeneBank: AB065893, AF399566, BK004525, NM_001005465   ORDB: ORL3695   
Build #39 labels OR10G3
Chromosomal location 14:21,569,806-21,570,744 (-)
Cluster 14@22b
Synteny CLIC#35
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10G1P 75.76% 297
OR10G2 75% 296

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10G6 59% 303
Chimp CONTIG1000.56-1612 99% 313
Mouse Or10g3 87% 313
Mouse Or10g3b 84% 313
Rat Or10g3 86% 313
Rat Or10g3c 83% 313
Cow OR10G3 89% 313

Expression evidences

Source Accession
mRNA AB528817
GNF Atlas2 gnf1h02180_at

Sequence information

Nucleotide sequence ATGGAAAGAATCAACAGCACACTGTTGACTGCGTTTATCCTGACAGGAATTCCGTATCCA
CTCAGGCTAAGGACACTCTTTTTTGTGTTCTTTTTTCTAATCTACATCCTGACTCAGCTG
GGAAACCTGCTTATTTTAATCACTGTCTGGGCAGACCCAAGGCTCCATGCCCGCCCCATG
TACATCTTTCTTGGTGTTCTCTCAGTCATTGATATGAGCATCTCCTCCATCATTGTCCCT
CGCCTCATGATGAACTTCACTTTAGGTGTCAAACCCATCCCATTTGGTGGCTGTGTTGCT
CAACTCTATTTCTATCACTTCCTGGGCAGCACCCAGTGCTTCCTCTACACCCTAATGGCC
TATGACAGGTACCTGGCAATATGTCAGCCCCTGCGCTACCCTGTGCTCATGACTGCTAAG
CTGAGCGCCTTGCTTGTGGCTGGAGCCTGGATGGCAGGATCCATCCATGGGGCTCTCCAG
GCCATCCTAACCTTCCGCCTGCCCTACTGTGGGCCCAATCAGGTGGATTACTTCTTCTGT
GACATCCCTGCAGTGTTGAGACTGGCCTGTGCTGACACAACAGTCAACGAGCTGGTGACG
TTTGTAGACATTGGGGTGGTGGTTGCCAGTTGCTTCTCCCTGATCCTCCTCTCCTACATA
CAGATCATTCAGGCCATCCTGAGAATCCACACAGCTGATGGGCGGCGCCGGGCTTTTTCA
ACTTGTGGAGCCCATGTAACCGTGGTCACCGTGTACTATGTGCCCTGTGCCTTCATCTAC
CTGAGGCCTGAAACCAACAGCCCCCTGGATGGGGCAGCTGCCCTAGTCCCCACGGCCATC
ACTCCTTTCCTCAACCCCCTTATCTACACTCTGCGGAACCAAGAGGTGAAGCTGGCCCTG
AAAAGAATGCTCAGAAGCCCAAGAACTCCGAGTGAGGTT
Conceptual translation MERINSTLLTAFILTGIPYPLRLRTLFFVFFFLIYILTQLGNLLILITVWADPRLHARPM
YIFLGVLSVIDMSISSIIVPRLMMNFTLGVKPIPFGGCVAQLYFYHFLGSTQCFLYTLMA
YDRYLAICQPLRYPVLMTAKLSALLVAGAWMAGSIHGALQAILTFRLPYCGPNQVDYFFC
DIPAVLRLACADTTVNELVTFVDIGVVVASCFSLILLSYIQIIQAILRIHTADGRRRAFS
TCGAHVTVVTVYYVPCAFIYLRPETNSPLDGAAALVPTAITPFLNPLIYTLRNQEVKLAL
KRMLRSPRTPSEV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 NS T/C S/G 1000GP (YRI)
14 100 -100 SYN G/T I/I 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
14 21,569,870 21,569,870 NS C/T R/Q 1000GP (CHBJPT)
14 21,569,960 21,569,960 NS C/T R/K 1000GP (CHBJPT)
14 21,569,994 21,569,994 NS C/T V/M 1000GP (CEU)
14 21,570,031 21,570,031 SYN A/C A/A 1000GP (CEU)
14 21,570,079 21,570,079 SYN G/T I/I 1000GP (CEU)
14 21,570,319 21,570,319 SYN G/A S/S 1000GP (CEU, CHBJPT)
14 21,570,394 21,570,394 SYN G/T T/T 1000GP (CEU, CHBJPT)
14 21,570,431 21,570,431 NS T/C Y/C 1000GP (CEU)
14 21,570,513 21,570,513 NS T/C I/V 1000GP (CEU)
14 21,570,528 21,570,528 NS T/C S/G 1000GP (CEU, CHBJPT)
14 21,570,600 21,570,600 NS C/G V/L 1000GP (CEU)
14 22,038,125 22,038,125 NS C/T V/M rs34162196 (DbSNP)
14 22,038,162 22,038,162 SYN A/C A/A rs17197261 (DbSNP)
14 22,038,210 22,038,210 SYN G/T I/I rs17792766 (DbSNP)
14 22,038,268 22,038,268 NS T/G D/A rs61738890 (DbSNP)
14 22,038,276 22,038,276 SYN C/T T/T rs28436899 (DbSNP)
14 22,038,377 22,038,377 SYN G/A L/L rs61743458 (DbSNP)
14 22,038,379 22,038,379 NS T/C H/R rs61743457 (DbSNP)
14 22,038,450 22,038,450 SYN A/G S/S rs11626669 (DbSNP)
14 22,038,525 22,038,525 SYN G/T T/T rs11626693 (DbSNP)
14 22,038,562 22,038,562 NS C/T C/Y rs45612332 (DbSNP)
14 22,038,650 22,038,650 NS A/T S/T rs12887316 (DbSNP)
14 22,038,659 22,038,659 NS C/T G/S rs17792778 (DbSNP)
14 22,038,731 22,038,731 NS C/G V/L rs12886819 (DbSNP)
14 22,038,798 22,038,798 SYN G/A L/L rs61744486 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 21,931,624 22,169,502 CopyNumber Variation_5318 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R292Q R262K V251M R235Q V202I Y105C I78V S73G V49L I45M % Freq CORP
1 R R V R V Y I G V I 62.44 0.109
2 R R V R V Y I S V I 26.19 0.109
3 R R M R V Y I G V I 4.61 0.109
4 R R V R V C I G V I 1.92 0.109
5 Q R V R V Y I S V I 1.46 0.109
6 R R V R V Y I S L I 1.23 0.109
7 R K V R V Y I G V I 0.69 0.109
8 R R V Q V Y I S V I 0.46 0.109
9 R R V R I Y I G V I 0.38 0.109
10 R R V R V Y V G V I 0.31 0.109
11 R R V Q V Y I G V I 0.08 0.109
12 R R V R V Y I G V M 0.08 0.109
13 R R M R V Y I S V I 0.08 0.109
14 R R V R V Y I G L I 0.08 0.109

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10G3.aApr07-unspliced main_exon 3UTR chr14 21,569,803 21,569,806 -
CDS chr14 21,569,806 21,570,744 -