Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10G4 Olfactory Receptor

Gene Symbol OR10G41 (View this gene in GeneCards)
Family 10
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR11-278, HsOR11.18.11, ORL3288
External Ids HGNC: 14809   GeneBank: AB065757, BK004502, NM_001004462   ORDB: ORL3288   
Build #39 labels OR10G4
Chromosomal location 11:124,015,575-124,016,507 (+)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10G7 91.42% 303
OR10G8 87.14% 311
OR10G9 94.82% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10G7 82% 311
Dog OR10G9C 86% 311
Dog OR10G9 85% 311
Dog OR10G7B 84% 304
Chimp CONTIG*********** 94% 309
Chimp CONTIG*********** 91% 303
Chimp CONTIG*********** 89% 309
Mouse Or10g9 86% 311
Mouse Or10g9b 85% 310
Mouse Or10g7 85% 311
Rat Or10g9 86% 309
Rat Or10g9b 85% 310
Rat Or10g7-ps 82% 311
Cow OR10G9E 82% 311
Cow OR10G9D 80% 311
Cow OR10G4B 82% 311
Cow OR10G4P 84% 291
Cow OR10G9H 81% 253

Expression evidences

Source Accession
GNF Atlas2 gnf1h05557_at
GNF Atlas2 gnf1h05558_s_at

Sequence information

Nucleotide sequence ATGTCCAACGCCAGCCTCGTGACAGCATTCATCCTCACAGGCCTTCCCCATGCCCCAGGG
CTGGACGCCCTCCTCTTTGGAATCTTCCTGGTGGTTTACGTGCTCACTGTGCTGGGGAAC
CTCCTCATCCTGCTGGTGATCAGGGTGGATTCTCACCTCCACACCCCCATGTACTACTTC
CTCACCAACCTGTCCTTCATTGACATGTGGTTCTCCACTGTCACGGTGCCCAAAATGCTG
ATGACCTTGGTGTCCCCAAGCGGCAGGGCTATCTCCTTCCACAGCTGCGTGGCTCAGCTC
TATTTTTTCCACTTCCTGGGGAGCACCGAGTGTTTCCTCTACACAGTCATGTCCTATGAT
CGCTACTTGGCCATCAGTTACCCGCTCAGGTACACCAGCATGATGAGTGGGAGCAGGTGT
GCCCTCCTGGCCACCGGCACTTGGCTCAGTGGCTCTCTGCACTCTGCTGTCCAGACCATA
TTGACTTTCCATTTGCCCTACTGTGGACCCAACCAGATCCAGCACTACTTCTGTGACGCA
CCGCCCATCCTGAAACTGGCCTGTGCAGACACCTCAGCCAACGTGATGGTCATCTTTGTG
GACATTGGGATAGTGGCCTCAGGCTGCTTTGTCCTGATAGTGCTGTCCTATGTGTCCATC
GTCTGTTCCATCCTGCGGATCCGCACCTCAGATGGGAGGCGCAGAGCCTTTCAGACCTGT
GCCTCCCACTGTATTGTGGTCCTTTGCTTCTTTGTTCCCTGTGTTGTCATTTATCTGAGG
CCAGGCTCCATGGATGCCATGGATGGAGTTGTGGCCATTTTCTACACTGTGCTGACGCCC
CTTCTCAACCCTGTTGTGTACACCCTGAGAAACAAGGAGGTGAAGAAAGCTGTGTTGAAA
CTTAGAGACAAAGTAGCACATCCTCAGAGGAAA
Conceptual translation MSNASLVTAFILTGLPHAPGLDALLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYD
RYLAISYPLRYTSMMSGSRCALLATGTWLSGSLHSAVQTILTFHLPYCGPNQIQHYFCDA
PPILKLACADTSANVMVIFVDIGIVASGCFVLIVLSYVSIVCSILRIRTSDGRRRAFQTC
ASHCIVVLCFFVPCVVIYLRPGSMDAMDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLK
LRDKVAHPQRK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T A/V 1000GP (YRI, YRI, YRI)
11 100 -100 SYN A/G A/A 1000GP (YRI, YRI, YRI)
11 123,886,290 123,886,290 NS C/G N/K rs547870 (DbSNP)
11 123,886,308 123,886,308 SYN A/G A/A rs11219407 (DbSNP)
11 123,886,320 123,886,320 SYN A/G T/T rs12224056 (DbSNP)
11 123,886,352 123,886,352 NS T/C L/P rs547068 (DbSNP)
11 123,886,395 123,886,394 Ins(1) -/G rs35933133 (DbSNP)
11 123,886,466 123,886,466 NS C/T T/I rs12422129 (DbSNP)
11 123,886,583 123,886,583 NS A/G Y/C rs4474449 (DbSNP)
11 123,886,681 123,886,681 NS G/A V/M rs1893766 (DbSNP)
11 123,886,698 123,886,698 SYN A/G R/R rs3017762 (DbSNP)
11 123,886,717 123,886,717 NS T/G C/G rs503223 (DbSNP)
11 123,886,796 123,886,796 NS A/G Q/R rs72472246 (DbSNP)
11 123,886,809 123,886,809 SYN C/T Y/Y rs3017763 (DbSNP)
11 123,886,812 123,886,812 NS C/G F/L rs3017764 (DbSNP)
11 123,886,822 123,886,822 NS T/C S/P rs1893764 (DbSNP)
11 123,886,865 123,886,865 NS A/T E/V rs4084209 (DbSNP)
11 123,886,958 123,886,958 NS A/G Q/R rs11219408 (DbSNP)
11 123,886,984 123,886,984 NS A/G R/G rs4936880 (DbSNP)
11 123,887,164 123,887,164 NS A/C K/Q rs4936881 (DbSNP)
11 123,887,175 123,887,175 SYN A/G V/V rs61908597 (DbSNP)
11 123,887,184 123,887,184 SYN G/T L/L rs4936882 (DbSNP)
11 124,015,600 124,015,600 NS C/T A/V 1000GP (CEU, CHBJPT)
11 124,015,601 124,015,601 SYN A/G A/A 1000GP (CEU, CHBJPT)
11 124,015,613 124,015,613 SYN A/G T/T 1000GP (CEU, CHBJPT)
11 124,015,645 124,015,645 NS T/C L/P 1000GP (CEU)
11 124,016,277 124,016,277 NS A/G R/G 1000GP (CEU, CHBJPT)
11 124,016,477 124,016,477 SYN T/G L/L 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 123,885,722 123,894,275 CopyNumber Variation_101364 (DGV)
11 123,886,182 123,889,214 Deletion #293 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A9V L24P M134V G146S V195E R226Q R235G K295Q % Freq CORP
1 A L M G V R R K 31.34 0.138
2 V L V G E R G Q 28.96 0.138
3 A P M G E R R K 14.29 0.138
4 A L M G E R R K 8.99 0.138
5 A L V S E R G Q 6.37 0.138
6 A L V G E R G Q 2.76 0.138
7 V L M G E R G Q 1.46 0.138
8 A L M S E R G Q 1.08 0.138
9 V L V G V R G Q 0.69 0.138
10 V L V G E R G K 0.54 0.138
11 A L M G E R G Q 0.46 0.138
12 V L M G E R R K 0.38 0.138
13 V L V S E R G Q 0.31 0.138
14 V L V G V R R K 0.31 0.138
15 A L M S E R R K 0.31 0.138
16 A L V S E R G K 0.23 0.138
17 A L M G V R G Q 0.23 0.138
18 A L V S E R R Q 0.15 0.138
19 A L V S E Q G Q 0.15 0.138
20 A L V G V R G Q 0.15 0.138
21 V L V G E R R Q 0.15 0.138
22 A L M S E R G K 0.08 0.138
23 V L V S E R R K 0.08 0.138
24 A P M G V R R K 0.08 0.138
25 V L M G V R R K 0.08 0.138
26 V L V S V R G Q 0.08 0.138
27 A L V G V R R K 0.08 0.138
28 A L M S E Q G Q 0.08 0.138
29 V L M S E R G Q 0.08 0.138
30 V L M G V R G Q 0.08 0.138

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10G4.aApr07-unspliced main_exon CDS chr11 124,015,575 124,016,507 +
3UTR chr11 124,016,507 124,016,510 +