Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10G8 Olfactory Receptor

Gene Symbol OR10G81 (View this gene in GeneCards)
Family 10
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.1 (functional)
Aliases OR11-274, OR11-282, HsOR11.18.13, ORL3377
External Ids HGNC: 14845   GeneBank: AB065755, BK004510, BK004571, NM_001004464   ORDB: ORL3377   
Build #39 labels OR10G8
Chromosomal location 11:124,029,623-124,030,555 (+)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10G4 87.14% 311
OR10G7 88.1% 311
OR10G9 88.1% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10G7 82% 311
Dog OR10G7B 81% 311
Dog OR10G9 84% 311
Dog OR10G9C 84% 311
Chimp CONTIG*********** 95% 310
Mouse Or10g9 83% 311
Mouse Or10g7 82% 311
Mouse Or10g9b 83% 309
Rat Or10g9 83% 309
Rat Or10g9b 82% 309
Rat Or10g7-ps 81% 311
Cow OR10G9D 78% 311

Expression evidences

Source Accession
mRNA BC136920

Sequence information

Nucleotide sequence ATGTCCAACGCCAGCCTACTGACAGCGTTCATCCTCATGGGCCTTCCCCATGCCCCAGCG
CTGGACGCCCCCCTCTTTGGAGTCTTCCTGGTGGTTTACGTGCTCACTGTGCTGGGGAAC
CTCCTCATCCTGCTGGTGATCAGGGTGGATTCTCACCTCCACACCACCATGTACTACTTC
CTCACCAACCTGTCGTTCATTGACATGTGGTTCTCCACTGTCACGGTGCCCAAATTGCTG
ATGACTTTGGTGTTCCCAAGTGGCAGGGCTATCTCCTTCCACAGCTGCATGGCTCAGCTC
TATTTCTTTCACTTCCTAGGGGGCACCGAGTGTTTCCTCTACAGGGTCATGTCCTGTGAT
CGCTACCTGGCCATCAGTTACCCGCTCAGGTACACCAGCATGATGACTGGGCGCTCGTGT
ACTCTTCTGGCCACCAGCACTTGGCTCAGTGGCTCTCTGCACTCTGCTGTCCAGGCCATA
TTGACTTTCCATTTGCCCTACTGTGGACCCAACTGGATCCAGCACTATTTGTGTGATGCA
CCGCCCATCCTGAAACTGGCCTGTGCAGACACCTCAGCCATAGAGACTGTCATTTTTGTG
ACTGTTGGAATAGTGGCCTCGGGCTGCTTTGTCCTGATAGTGCTGTCCTATGTGTCCATC
GTCTGTTCCATCCTGCGGATCCGCACCTCAGAGGGGAAGCACAGAGCCTTTCAGACCTGT
GCCTCCCACTGTATCGTGGTCCTTTGCTTCTTTGGCCCTGGTCTTTTCATTTACCTGAGG
CCAGGCTCCAGGAAAGCTGTGGATGGAGTTGTGGCCGTTTTCTACACTGTGCTGACGCCC
CTTCTCAACCCTGTTGTGTACACCCTGAGGAACAAGGAGGTGAAGAAAGCTCTGTTGAAG
CTGAAAGACAAAGTAGCACATTCTCAGAGCAAA
Conceptual translation MSNASLLTAFILMGLPHAPALDAPLFGVFLVVYVLTVLGNLLILLVIRVDSHLHTTMYYF
LTNLSFIDMWFSTVTVPKLLMTLVFPSGRAISFHSCMAQLYFFHFLGGTECFLYRVMSCD
RYLAISYPLRYTSMMTGRSCTLLATSTWLSGSLHSAVQAILTFHLPYCGPNWIQHYLCDA
PPILKLACADTSAIETVIFVTVGIVASGCFVLIVLSYVSIVCSILRIRTSEGKHRAFQTC
ASHCIVVLCFFGPGLFIYLRPGSRKAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLK
LKDKVAHSQSK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A R/H 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN G/T L/L 1000GP (YRI)
11 123,900,382 123,900,382 NS C/T A/V rs73028928 (DbSNP)
11 123,900,385 123,900,385 NS A/C Q/P rs73028930 (DbSNP)
11 123,900,401 123,900,401 SYN C/G P/P rs28485314 (DbSNP)
11 123,900,866 123,900,866 SYN C/T D/D rs28711441 (DbSNP)
11 123,901,175 123,901,175 SYN A/C L/L rs11825515 (DbSNP)
11 124,029,664 124,029,664 SYN C/A G/G 1000GP (CHBJPT)
11 124,029,987 124,029,987 NS A/G Y/C 1000GP (CHBJPT)
11 124,030,209 124,030,209 NS C/T T/I 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 123,900,230 123,903,262 Deletion #228 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

P19Q R121H Y122C C140Y N171S T196I I213V % Freq CORP
1 P R Y C N T I 85.41 0.255
2 P R C C N I I 6.68 0.182
3 Q R Y C N T I 4.22 0.255
4 P R Y Y N T I 2.23 0.255
5 P R Y C N T V 0.61 0.255
6 P R Y C S T I 0.38 0.255
7 P H Y C N T I 0.23 0.859
8 P R C C N T I 0.15 0.182
9 Q R Y C S T I 0.08 0.255

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10G8.aApr07-unspliced main_exon CDS chr11 124,029,623 124,030,555 +
3UTR chr11 124,030,555 124,030,558 +