Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10G9 Olfactory Receptor

Gene Symbol OR10G91 (View this gene in GeneCards)
Family 10
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR11-272, HsOR11.18.12
External Ids HGNC: 15129   GeneBank: AB065756, BK004760, NM_001001953   
Build #39 labels OR10G9, OR10G10P
Chromosomal location 11:124,023,013-124,023,945 (+)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10G4 94.82% 309
OR10G7 90.03% 311
OR10G8 88.1% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10G7 84% 309
Dog OR10G9 87% 311
Dog OR10G9C 87% 311
Dog OR10G7B 84% 311
Chimp CONTIG*********** 97% 311
Mouse Or10g9 87% 311
Mouse Or10g9b 86% 309
Mouse Or10g7 87% 302
Rat Or10g9 87% 309
Rat Or10g9b 85% 309
Rat Or10g7-ps 83% 311
Cow OR10G9E 82% 311
Cow OR10G9 81% 311
Cow OR10G9D 81% 311
Cow OR10G4B 81% 311
Cow OR10G4P 83% 291
Cow OR10G9F 81% 294
Cow OR10G9G 81% 291
Cow OR10G9H 81% 253

Sequence information

Nucleotide sequence ATGTCCAAGACCAGCCTCGTGACAGCGTTCATCCTCACGGGCCTTCCCCATGCCCCAGGG
CTGGACGCCCCACTCTTTGGAATCTTCCTGGTGGTTTACGTGCTCACTGTGCTGGGGAAC
CTCCTCATCCTGCTGGTGATCAGGGTGGATTCTCACCTCCACACCCCCATGTACTACTTC
CTCACCAACCTGTCCTTCATTGACATGTGGTTCTCCACTGTCACGGTGCCCAAAATGCTG
ATGACCTTGGTGTCCCCAAGCGGCAGGGCTATCTCCTTCCACAGCTGCGTGGCTCAGCTC
TATTTTTTCCACTTCCTGGGGAGCACCGAGTGTTTCCTCTACACAGTCATGTCCTATGAT
CGCTACTTGGCCATCAGTTACCCGCTCAGGTACACCAGCATGATGAGTGGGAGCAGATGT
GCCCTCCTGGCCACCAGCACTTGGCTCAGTGGCTCTCTGCACTCTGCTGTCCAGACCATA
TTGACTTTCCATTTGCCCTACTGTGGACCCAACCAGATCCAGCACTATTTGTGTGATGCA
CCGCCCATCCTGAAACTGGCCTGTGCAGACACCTCAGCCAACGAGATGGTCATCTTTGTG
GACATTGGGCTAGTGGCCTCGGGCTGCTTTCTCCTGATAGTGCTGTCTTATGTGTCCATC
GTCTGTTCCATCCTGCGGATCCACACCTCAGAGGGGAGGCACAGAGCCTTTCAGACCTGT
GCCTCCCACTGCATCGTGGTCCTTTGCTTTTTTGTTCCCTGTGTTTTCATTTACCTGAGA
CCAGGCTCCAGGGACGTCGTGGATGGAGTTGTGGCCATTTTCTACACTGTGCTGACACCC
CTTCTCAACCCTGTTGTGTACACCCTGAGAAACAAGGAGGTGAAGAAAGCTGTGTTGAAA
CTGAGAGACAAAGTAGCACATTCTCAGGGAGAA
Conceptual translation MSKTSLVTAFILTGLPHAPGLDAPLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYD
RYLAISYPLRYTSMMSGSRCALLATSTWLSGSLHSAVQTILTFHLPYCGPNQIQHYLCDA
PPILKLACADTSANEMVIFVDIGLVASGCFLLIVLSYVSIVCSILRIHTSEGRHRAFQTC
ASHCIVVLCFFVPCVFIYLRPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLK
LRDKVAHSQGE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T A/V 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A G/G 1000GP (YRI)
11 123,893,729 123,893,729 NS G/A A/T rs634361 (DbSNP)
11 123,893,791 123,893,791 SYN A/C/G P/P rs3017765 (DbSNP)
11 123,894,119 123,894,119 NS A/G M/V rs12366219 (DbSNP)
11 123,894,126 123,894,126 NS C/G T/S rs17128190 (DbSNP)
11 123,894,136 123,894,136 SYN A/G R/R rs28499345 (DbSNP)
11 123,894,234 123,894,234 NS A/G Q/R rs11219413 (DbSNP)
11 123,894,256 123,894,256 SYN T/C D/D rs2924497 (DbSNP)
11 123,894,339 123,894,339 NS C/T S/L rs12363627 (DbSNP)
11 123,894,361 123,894,361 SYN G/T V/V rs61908611 (DbSNP)
11 123,894,402 123,894,402 NS A/G H/R rs12221656 (DbSNP)
11 123,894,469 123,894,469 SYN C/T F/F rs12577318 (DbSNP)
11 123,894,553 123,894,553 SYN A/G L/L rs61908612 (DbSNP)
11 123,894,556 123,894,556 SYN A/G T/T rs12574086 (DbSNP)
11 123,894,560 123,894,560 NS C/T L/F rs12790359 (DbSNP)
11 123,894,611 123,894,611 NS C/G L/V rs12576297 (DbSNP)
11 124,023,038 124,023,038 NS C/T A/V 1000GP (CHBJPT)
11 124,023,610 124,023,610 NS G/T V/L 1000GP (CHBJPT)
11 124,023,622 124,023,622 NS C/G L/V 1000GP (CHBJPT)
11 124,023,632 124,023,632 NS C/T S/L 1000GP (CEU)
11 124,023,748 124,023,748 NS G/C V/L 1000GP (CEU)
11 124,023,846 124,023,846 SYN G/A L/L 1000GP (CEU)
11 124,023,849 124,023,849 SYN A/G T/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 123,885,722 123,894,275 CopyNumber Variation_101364 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A9V M134V Q172R Y176C V200L I202F S207L H228R V267M D268G % Freq CORP
1 A M Q Y V I S H V D 37.02 0.138
2 A V Q Y V I S H V D 24.19 0.138
3 A M R Y V I S R V D 20.35 0.138
4 V M R C L I S R V D 6.99 0.118
5 V M Q Y V I S H V D 3.15 0.138
6 A M Q Y V F S H V D 2.00 0.138
7 A M R Y V I S H V D 1.23 0.138
8 A M Q Y V I S H M D 0.92 0.138
9 A M Q Y V I S H V G 0.77 0.138
10 V M R C L I S H V D 0.69 0.118
11 A V Q Y V I L H V D 0.61 0.138
12 A M Q Y V I S R V D 0.38 0.138
13 A M R C L I S R V D 0.31 0.118
14 A V Q Y V I S H V G 0.23 0.138
15 A V Q Y V I S R V D 0.15 0.138
16 V M R Y V I S R V D 0.15 0.138
17 V M Q Y V I L H V D 0.08 0.138
18 A M Q Y L I S R V D 0.08 0.138
19 A M Q Y V F S R V D 0.08 0.138
20 V M R C V I S H V D 0.08 0.118
21 V M Q Y V I S R V D 0.08 0.138
22 A M R C L I S H V D 0.08 0.118
23 A M R Y V I S R V G 0.08 0.138
24 A M Q Y V I L H V D 0.08 0.138
25 V M R C V I S R V D 0.08 0.118
26 A V Q Y V F S H V D 0.08 0.138
27 V M R Y V I S H V D 0.08 0.138

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10G9.aApr07-unspliced main_exon CDS chr11 124,023,013 124,023,945 +
3UTR chr11 124,023,945 124,023,948 +