Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10H1 Olfactory Receptor

Gene Symbol OR10H11 (View this gene in GeneCards)
Family 10
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases AC004510, OR19-27, HsOR19.4.4, ORL733, ORL525
External Ids HGNC: 8172   GeneBank: AF399584, BK004210, NM_013940   ORDB: ORL733, ORL525   
Build #39 labels OR10H1
Chromosomal location 19:15,807,084-15,808,037 (-)
Cluster 19@16a
Synteny CLIC#46
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10H2 89.58% 307
OR10H5 93.61% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10H1 88% 314
Dog OR10H1E 86% 312
Dog OR10H2 83% 311
Chimp CONTIG716.57-870 89% 307
Mouse Or10h1 87% 310
Mouse Or10h1b 86% 310
Rat Or10h1d 87% 310
Rat Or10h1c 85% 310
Rat Or10h1 87% 300
Cow OR10H1 89% 314
Cow OR10H1H 87% 309
Cow OR10H1G 86% 270
Cow OR10H2B 80% 311

Expression evidences

Source Accession
ESTs CO246691
mRNA BC132969
GNF Atlas2 208558_at

Sequence information

Nucleotide sequence ATGCAGAGAGCCAATCACTCCACAGTGACCCAATTCATCCTCGTCGGCTTCTCTGTCTTC
CCCCACCTCCAGCTGATGCTCTTCCTGCTGTTCCTGCTGATGTACCTGTTCACGCTGCTG
GGCAACCTGCTCATCATGGCCACCGTCTGGAGCGAGCGCAGCCTCCACACGCCCATGTAC
CTCTTCCTGTGCGCCCTCTCCGTCTCCGAGATCCTCTACACCGTGGCCATCATCCCGCGC
ATGCTGGCCGACCTGCTGTCCACCCAGCGCTCCATCGCCTTCCTGGCCTGTGCCAGTCAG
ATGTTCTTCTCCTTCAGCTTCGGCTTCACCCACTCCTTCCTGCTCACCGTCATGGGCTAC
GACCGCTACGTGGCCATCTGCCACCCCCTGCGCTACAACGTGCTCATGAGCCCGCGGGGC
TGCGCCTGCCTGGTGGGCTGCTCCTGGGCTGGTGGCTTGGTCATGGGGATGGTGGTGACC
TCGGCCATTTTCCACCTCGCCTTCTGTGGACACAAGGAGATCCACCATTTTGCTTGCCAT
GTGCCACCTCTGTTGAAGTTGGCCTGTGGAGACGATGTGCTGGTGGTGGCCAAAGGCGTG
GGCTTGGTGTGTATCACGGCCCTGCTGGGCTGTTTTCTCCTCATCCTCCTCTCCTATGCC
TTCATCGTGGCCGCCATCTTGAAGATCCCTTCTGCTGAAGGTCGGAACAAGGCCTTCTCC
ACCTGTGCCTCTCACCTCACTGTGGTGGTCGTGCACTATGGCTTTGCCTCCGTCATTTAC
CTGAAGCCCAAAAGTCCCCAGTCTCTGGAAGGAGACACCTTGATGGGCATCACCTACACG
GTCCTCACACCCTTCCTCAGCCCCATCATCTTCAGCCTCAGGAACAAGGAGCTGAAGGTC
GCCATGAAGAAGACCTTCTTCAGTAAACTCTACCCAGAAAAAAATGTAATGATG
Conceptual translation MQRANHSTVTQFILVGFSVFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMY
LFLCALSVSEILYTVAIIPRMLADLLSTQRSIAFLACASQMFFSFSFGFTHSFLLTVMGY
DRYVAICHPLRYNVLMSPRGCACLVGCSWAGGLVMGMVVTSAIFHLAFCGHKEIHHFACH
VPPLLKLACGDDVLVVAKGVGLVCITALLGCFLLILLSYAFIVAAILKIPSAEGRNKAFS
TCASHLTVVVVHYGFASVIYLKPKSPQSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKV
AMKKTFFSKLYPEKNVMM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 100 -100 NS C/G G/R 1000GP (YRI)
19 15,807,992 15,807,992 NS C/G G/R 1000GP (CEU, CHBJPT)
19 15,918,008 15,918,008 SYN C/A T/T rs61745312 (DbSNP)
19 15,918,177 15,918,177 NS G/T A/D rs62619246 (DbSNP)
19 15,918,251 15,918,251 SYN G/A G/G rs61746476 (DbSNP)
19 15,918,275 15,918,275 SYN G/A D/D rs61746475 (DbSNP)
19 15,918,323 15,918,323 NS C/G Q/H rs1859298 (DbSNP)
19 15,918,349 15,918,349 NS T/C T/A rs61745313 (DbSNP)
19 15,918,380 15,918,380 SYN C/T G/G rs28426969 (DbSNP)
19 15,918,390 15,918,390 NS A/G L/S rs4081569 (DbSNP)
19 15,918,433 15,918,433 NS A/G W/R rs8103631 (DbSNP)
19 15,918,434 15,918,434 SYN A/C/T P/P rs1859299 (DbSNP)
19 15,918,455 15,918,455 SYN A/G R/R rs61739573 (DbSNP)
19 15,918,647 15,918,647 SYN G/T S/S rs4081570 (DbSNP)
19 15,918,654 15,918,654 NS A/G V/A rs4808382 (DbSNP)
19 15,918,802 15,918,802 NS C/G G/R rs4808383 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 27 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A167T A142T A65V G16R % Freq CORP
1 A A A G 83.03 0.148
2 A A A R 13.29 0.148
3 T A A G 1.69 0.148
4 A A V R 1.54 0.148
5 A T A G 0.46 0.148

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10H1.aApr07-unspliced main_exon 3UTR chr19 15,807,003 15,807,084 -
CDS chr19 15,807,084 15,808,037 -
5UTR chr19 15,808,037 15,808,126 -