Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10H3 Olfactory Receptor

Gene Symbol OR10H31 (View this gene in GeneCards)
Family 10
Subfamily H
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR19-24, AC004597-B, HsOR19.4.2, ORL313, ORL527
External Ids HGNC: 8174   GeneBank: BK004212, NM_013938   ORDB: ORL313, ORL527   
Build #39 labels OR10H3
Chromosomal location 19:15,741,393-15,742,340 (+)
Cluster 19@16a
Synteny CLIC#46
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10H4 89.87% 316

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10H4 82% 314
Dog OR10H4C 82% 308
Dog OR10H4D 81% 308
Dog OR10H4E 80% 308
Dog OR10H4F 81% 282
Chimp CONTIG*********** 96% 316
Mouse Or10h28 77% 315
Rat Or10h28 78% 315
Cow OR10H4P 80% 314
Cow OR10H4G 81% 308
Cow OR10H4H 82% 282

Expression evidences

Source Accession
mRNA AB529277
GNF Atlas2 208520_at

Sequence information

Nucleotide sequence ATGCCTGGTCAGAACTACAGAACCATATCTGAATTTATCCTCTCTGGCTTCTCAGCCTTC
CCCCAGCAGCTCCTGCCTGTCTTGTTCCTGCTGTACCTCCTGATGTTCCTGTTCACATTG
CTTGGCAACCTTCTTATCATGGCCACAGTTTGGATTGAACGCAGACTCCACACACCCATG
TACCTCTTCTTGTGTGCCCTCTCCATCTCTGAGATTCTGTTCACTGTTGCCATCACCCCT
CGCATGCTGGCTGATCTGCTCTTCACCCATCGTTCCATCACCTTTGTGGCTTGTGCCATT
CAGATGTTCTTCTCCTTCATGTTTGGCTTCACTCACTCCTTCCTTCTCATGGTCATGGGC
TATGATCACTACGTGACCATCTGCCACCCACTGCATTACAACATGCTAATGAGTCCCCGT
GGCTGTGCCCATCTTGTGGCCTGGACCTGGGCTGGTGGCTCGGTCATGGGGATGATGGTG
ACAATGATGGTTTTTCACCTCACTTTCTGTGGGTCTAATGTGATCCACCATTTTCTCTGT
CATGTGCTTTCCCTCTTGAAGTTGGCCTGTGGGAGCAAGACATCATCTGTCATCATGGGT
GTGATGCTGGTGTGTGTCACAGCCCTGATAGGCTGTTTGTTCCTCATCATCCTCTCCTTT
GTCTTCATTGTGGCTGCCATCTTGAGGATTCCTTCTGCTGAGGGCCGGCACAAGACTTTC
TCCACTTGTGTATCCCACCTCACTGTGGTGGTCATGCACTATAGTTTTGCCTCCCTTATC
TACCTCAAACCCAAGGGCCTCCATTCTATGTACAGTGATGCCTTGATGGCCACCACCTAT
ACTGTCTTCACCCCCTTCCTCAGCCCAATCATTTTCAGTCTAAGGAACAAGGAGCTGAAG
AATGCCATAAATAAAAACTTTTGCAGAAGGTTCTGCCCTCTAAGCTCC
Conceptual translation MPGQNYRTISEFILSGFSAFPQQLLPVLFLLYLLMFLFTLLGNLLIMATVWIERRLHTPM
YLFLCALSISEILFTVAITPRMLADLLFTHRSITFVACAIQMFFSFMFGFTHSFLLMVMG
YDHYVTICHPLHYNMLMSPRGCAHLVAWTWAGGSVMGMMVTMMVFHLTFCGSNVIHHFLC
HVLSLLKLACGSKTSSVIMGVMLVCVTALIGCLFLIILSFVFIVAAILRIPSAEGRHKTF
STCVSHLTVVVMHYSFASLIYLKPKGLHSMYSDALMATTYTVFTPFLSPIIFSLRNKELK
NAINKNFCRRFCPLSS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 100 -100 NS A/C R/S 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
19 100 -100 SYN C/T F/F 1000GP (YRI, YRI)
19 15,741,413 15,741,413 NS A/C R/S 1000GP (CEU, CHBJPT)
19 15,741,432 15,741,432 NS C/A L/I 1000GP (CEU, CHBJPT)
19 15,741,553 15,741,553 NS G/A R/H 1000GP (CEU, CHBJPT)
19 15,741,685 15,741,685 NS G/T C/F 1000GP (CHBJPT)
19 15,741,734 15,741,734 SYN C/T F/F 1000GP (CEU)
19 15,742,062 15,742,062 NS G/A V/M 1000GP (CEU, CHBJPT)
19 15,742,270 15,742,270 NS G/A S/N 1000GP (CEU, CHBJPT)
19 15,852,223 15,852,223 NS A/C R/S rs1966357 (DbSNP)
19 15,852,242 15,852,242 NS A/C I/L rs2240227 (DbSNP)
19 15,852,363 15,852,363 NS A/G H/R rs11670007 (DbSNP)
19 15,852,544 15,852,544 SYN C/T F/F rs11670326 (DbSNP)
19 15,852,872 15,852,872 NS A/G M/V rs2240228 (DbSNP)
19 15,853,080 15,853,080 NS A/G N/S rs2240229 (DbSNP)
19 15,853,150 15,853,150 SYN C/T S/S rs16980824 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
19 15,786,059 15,888,458 Inversion Variation_43709 (DGV)
19 15,852,103 15,855,150 CopyNumber #102 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R7S L14I F36S R54H Y121C V224M S293N % Freq CORP
1 S L F H Y V S 25.81 1.000
2 S L F R Y M S 20.89 1.000
3 R I F R Y V S 19.43 1.000
4 S L F R Y V N 15.05 1.000
5 R L F R Y V S 14.36 1.000
6 S L F R Y V S 3.84 1.000
7 R L F R Y M S 0.15 1.000
8 R I F R Y V N 0.15 1.000
9 S L F H Y M S 0.08 1.000
10 R L F R C V S 0.08 1.000
11 R L F R Y V N 0.08 1.000
12 S L S R Y V N 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10H3.aApr07-unspliced main_exon CDS chr19 15,741,393 15,742,340 +
3UTR chr19 15,742,340 15,742,343 +