Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10H4 Olfactory Receptor

Gene Symbol OR10H41 (View this gene in GeneCards)
Family 10
Subfamily H
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR19-28, HsOR19.4.5, ORL3760
External Ids HGNC: 15388   GeneBank: AB065921, AF399586, BK004270, NM_001004465   ORDB: ORL3760   
Build #39 labels OR10H4
Chromosomal location 19:15,949,008-15,949,955 (+)
Cluster 19@16b
Synteny CLIC#46
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10H3 89.87% 316

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10H4 81% 314
Dog OR10H4C 82% 309
Dog OR10H4D 81% 309
Dog OR10H4E 81% 309
Dog OR10H4F 82% 282
Chimp CONTIG*********** 97% 316
Mouse Or10h28 76% 315
Rat Or10h28 77% 315
Cow OR10H4P 82% 309
Cow OR10H4G 82% 309
Cow OR10H4H 82% 282
Cow OR10H4J 82% 278
Cow OR10H4I 81% 282

Sequence information

Nucleotide sequence ATGCCTAGTCAGAACTATAGCATCATATCTGAATTTAACCTCTTTGGCTTCTCAGCCTTC
CCCCAGCACCTCCTGCCCATCTTGTTCCTGCTGTACCTCCTGATGTTCCTGTTCACATTG
CTGGGCAACCTTCTCATCATGGCCACAATCTGGATTGAACACAGACTCCACACACCCATG
TACCTCTTCTTGTGCACCCTCTCCGTCTCTGAGATTCTGTTCACTGTTGCCATCACCCCT
CGCATGCTGGCTGATCTGCTTTCCACCCATCATTCCATCACCTTTGTGGCTTGTGCCAAC
CAGATGTTCTTCTCCTTCATGTTTGGCTTCACTCACTCCTTCCTTCTCCTGGTCATGGGC
TATGATCGCTATGTGGCCATCTGCCACCCACTGCGTTACAATGTGCTCATGAGCCCCCGT
GACTGTGCCCATCTTGTGGCCTGTACCTGGGCTGGTGGCTCAGTCATGGGGATGATGGTG
ACAACGATAGTTTTCCACCTCACTTTCTGTGGGTCTAATGTGATCCACCATTTTTTCTGT
CATGTGCTTTCCCTCTTGAAGTTGGCCTGTGAAAACAAGACATCATCTGTCATCATGGGT
GTGATGCTGGTGTGTGTCACAGCCCTGATAGGCTGTTTATTCCTCATCATCCTCTCCTAT
GTCTTCATTGTGGCTGCCATCTTGAGGATTCCCTCTGCCGAAGGCCGGCACAAGACATTT
TCTACGTGTGTATCCCACCTCACTGTGGTGGTCACGCACTATAGTTTTGCCTCCTTTATC
TACCTCAAGCCCAAGGGCCTCCATTCTATGTACAGTGACGCCTTGATGGCCACCACCTAT
ACTGTCTTCACCCCCTTCCTTAGCCCAATCATTTTCAGCCTAAGGAACAAGGAGCTGAAG
AATGCCATAAATAAAAACTTTTACAGAAAATTCTGTCCTCCAAGTTCC
Conceptual translation MPSQNYSIISEFNLFGFSAFPQHLLPILFLLYLLMFLFTLLGNLLIMATIWIEHRLHTPM
YLFLCTLSVSEILFTVAITPRMLADLLSTHHSITFVACANQMFFSFMFGFTHSFLLLVMG
YDRYVAICHPLRYNVLMSPRDCAHLVACTWAGGSVMGMMVTTIVFHLTFCGSNVIHHFFC
HVLSLLKLACENKTSSVIMGVMLVCVTALIGCLFLIILSYVFIVAAILRIPSAEGRHKTF
STCVSHLTVVVTHYSFASFIYLKPKGLHSMYSDALMATTYTVFTPFLSPIIFSLRNKELK
NAINKNFYRKFCPPSS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 100 -100 NS G/T C/F 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
19 100 -100 SYN C/T S/S 1000GP (YRI, YRI)
19 15,949,036 15,949,036 NS C/G S/C 1000GP (CEU)
19 15,949,211 15,949,211 SYN C/T S/S 1000GP (CEU, CHBJPT)
19 15,949,300 15,949,300 NS G/T C/F 1000GP (CEU, CHBJPT)
19 15,949,307 15,949,307 NS C/A N/K 1000GP (CEU, CHBJPT)
19 15,949,438 15,949,438 NS A/G H/R 1000GP (CEU, CHBJPT)
19 15,949,457 15,949,457 nonsense SNP G/A W/* 1000GP (CHBJPT)
19 15,949,848 15,949,848 NS A/G T/A 1000GP (CEU, CHBJPT)
19 16,060,004 16,060,003 Ins(1) -/T rs35723232 (DbSNP)
19 16,060,021 16,060,021 SYN C/T S/S rs16980821 (DbSNP)
19 16,060,117 16,060,117 NS A/C K/N rs16980994 (DbSNP)
19 16,060,248 16,060,248 NS A/G H/R rs16980822 (DbSNP)
19 16,060,523 16,060,523 NS C/T R/W rs61732447 (DbSNP)
19 16,060,658 16,060,658 NS A/G T/A rs11880184 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
19 16,031,569 16,060,989 CopyNumber Variation_89138 (DGV)
19 16,046,049 16,060,989 CopyNumber Variation_89146 (DGV)
19 16,059,718 16,062,765 CopyNumber #103 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S10C R81L R123H R140H H144R F179L A225D R236W T252M Y254H T281A % Freq CORP
1 S R R R H F A R T Y T 71.12 0.362
2 S R R R R F A R T Y A 25.42 0.362
3 S R R R R F A W T Y A 1.31 0.319
4 C R R R H F A R T Y T 0.46 0.362
5 S R R R H F D R T Y T 0.31 0.362
6 S R H R H F A R T Y T 0.23 0.910
7 S R R R R F A R T H A 0.23 0.132
8 S R R R H F A R M Y T 0.23 0.362
9 S R R R H F A W T Y T 0.15 0.319
10 S R R R R F A R T Y T 0.15 0.362
11 S R R R H L A R T Y T 0.08 0.362
12 S R R R H F A R T Y A 0.08 0.362
13 S R R R R F A R M Y A 0.08 0.362
14 S L R R R F A R T Y A 0.08 0.362
15 S R R H H F A R T Y T 0.08 0.362

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10H4.aApr07-unspliced main_exon CDS chr19 15,949,008 15,949,955 +
3UTR chr19 15,949,955 15,949,958 +