Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10H5 Olfactory Receptor

Gene Symbol OR10H51 (View this gene in GeneCards)
Family 10
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases OR19-25, OR19-26, HsOR19.4.3, ORL3761
External Ids HGNC: 15389   GeneBank: AB065920, AF399583, BK004271, BK004272, NM_001004466   ORDB: ORL3761   
Build #39 labels OR10H5
Chromosomal location 19:15,794,049-15,794,993 (+)
Cluster 19@16a
Synteny CLIC#46
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10H1 93.61% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10H1E 86% 313
Dog OR10H1 84% 314
Dog OR10H2 83% 313
Chimp CONTIG716.57-870 87% 311
Mouse Or10h1 85% 314
Mouse Or10h1b 84% 314
Rat Or10h1c 85% 312
Rat Or10h1d 84% 312
Rat Or10h1 86% 302
Cow OR10H1 86% 314
Cow OR10H1F 85% 311
Cow OR10H1H 85% 311
Cow OR10H1I 82% 310
Cow OR10H2 80% 315
Cow OR10H2B 81% 311
Cow OR10H1G 84% 270

Expression evidences

Source Accession
mRNA AB529278

Sequence information

Nucleotide sequence ATGCAGGGGCTAAACCACACCTCCGTGTCTGAATTCATCCTCGTTGGCTTCTCTGCCTTC
CCCCACCTCCAGCTGATGCTCTTCCTGCTGTTCCTGCTGATGTACCTGTTCACGCTGCTG
GGCAACCTGCTCATCATGGCCACTGTCTGGAGCGAGCGCAGCCTCCACATGCCCATGTAC
CTCTTCCTGTGTGCCCTCTCCATCACCGAGATCCTCTACACCGTGGCCATCATCCCGCGC
ATGCTGGCCGACCTGCTGTCCACCCAGCGCTCCATCGCCTTCCTGGCCTGTGCCAGTCAG
ATGTTCTTCTCCTTCAGCTTCGGCTTCACCCACTCCTTCCTGCTCACTGTCATGGGCTAC
GACCGCTACGTGGCCATCTGCCACCCCCTGCGTTACAACGTGCTCATGAGCCTGCGGGGC
TGCACCTGCCGGGTGGGCTGCTCCTGGGCTGGTGGCTTGGTCATGGGGATGGTGGTGACC
TCGGCCATTTTCCACCTCGCCTTCTGTGGACACAAGGAGATCCACCATTTCTTCTGCCAC
GTGCCACCTCTGTTGAAGTTGGCCTGTGGAGATGATGTGCTGGTGGTGGCCAAAGGCGTG
GGCTTGGTGTGTATCACGGCCCTGCTGGGCTGTTTTCTCCTCATCCTCCTCTCCTATGCC
TTCATCGTGGCCGCCATCTTGAAGATCCCTTCTGCTGAAGGTCGGAACAAGGCCTTCTCC
ACCTGTGCCTCTCACCTCACTGTGGTGGTCGTGCACTATGGCTTTGCCTCCGTCATTTAC
CTGAAGCCCAAAGGTCCCCAGTCTCCGGAAGGAGACACCTTGATGGGCATCACCTACACG
GTCCTCACACCCTTCCTCAGCCCCATCATCTTCAGCCTCAGGAACAAGGAGCTGAAGGTC
GCCATGAAGAAGACTTGCTTCACCAAACTCTTTCCACAGAACTGC
Conceptual translation MQGLNHTSVSEFILVGFSAFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHMPMY
LFLCALSITEILYTVAIIPRMLADLLSTQRSIAFLACASQMFFSFSFGFTHSFLLTVMGY
DRYVAICHPLRYNVLMSLRGCTCRVGCSWAGGLVMGMVVTSAIFHLAFCGHKEIHHFFCH
VPPLLKLACGDDVLVVAKGVGLVCITALLGCFLLILLSYAFIVAAILKIPSAEGRNKAFS
TCASHLTVVVVHYGFASVIYLKPKGPQSPEGDTLMGITYTVLTPFLSPIIFSLRNKELKV
AMKKTCFTKLFPQNC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 100 -100 NS G/A G/S 1000GP (YRI, YRI, YRI)
19 100 -100 SYN C/T L/L 1000GP (YRI, YRI, YRI, YRI)
19 15,794,192 15,794,192 SYN T/C T/T 1000GP (CEU)
19 15,794,396 15,794,396 SYN T/C T/T 1000GP (CEU)
19 15,794,479 15,794,479 NS G/T R/L 1000GP (CEU, CHBJPT)
19 15,794,621 15,794,621 SYN T/C D/D 1000GP (CEU)
19 15,794,851 15,794,851 NS C/A S/Y 1000GP (CEU)
19 15,902,588 15,902,589 large insertion 8016bp insertion rs72095917 (DbSNP)
19 15,904,972 15,904,972 SYN A/G T/T rs61741283 (DbSNP)
19 15,904,977 15,904,977 NS A/T Q/L rs61741282 (DbSNP)
19 15,905,002 15,905,002 SYN C/T T/T rs4808379 (DbSNP)
19 15,905,086 15,905,086 SYN C/T A/A rs61748357 (DbSNP)
19 15,905,179 15,905,179 SYN C/T F/F rs61748264 (DbSNP)
19 15,905,206 15,905,206 SYN C/T T/T rs4808380 (DbSNP)
19 15,905,271 15,905,271 NS C/T P/L rs61754881 (DbSNP)
19 15,905,276 15,905,276 NS A/G S/G rs61754880 (DbSNP)
19 15,905,289 15,905,289 NS G/T R/L rs61754873 (DbSNP)
19 15,905,414 15,905,414 NS A/C K/Q rs61741438 (DbSNP)
19 15,905,431 15,905,431 SYN C/T D/D rs4808381 (DbSNP)
19 15,905,468 15,905,468 NS G/T G/C rs62106065 (DbSNP)
19 15,905,505 15,905,505 NS C/T P/L rs62106066 (DbSNP)
19 15,905,529 15,905,529 NS A/C D/A rs62621417 (DbSNP)
19 15,905,639 15,905,639 SYN T/C L/L rs3746151 (DbSNP)
19 15,905,661 15,905,661 NS A/C Y/S rs67455341 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
19 15,875,235 15,905,462 CopyNumber Variation_35612 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

E11D A19V G140S R144L K186Q S268Y % Freq CORP
1 E A G R K S 66.74 0.148
2 E A G R K Y 22.35 0.148
3 E A G L K S 8.83 0.148
4 E A S R K Y 1.15 0.148
5 E A G L K Y 0.31 0.148
6 E V G R K Y 0.31 0.148
7 D A G R K S 0.15 0.148
8 E A G R Q S 0.15 0.148

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10H5.aApr07-unspliced main_exon CDS chr19 15,794,049 15,794,993 +
3UTR chr19 15,794,993 15,794,996 +