Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10J1 Olfactory Receptor

Gene Symbol OR10J11 (View this gene in GeneCards)
Family 10
Subfamily J
Pseudogene No
CORP pseudogene probability score 0.19 (functional)
Aliases OR1-26, HSHGMP07J, HsOR1.4.26, ORL21
External Ids HGNC: 8175   GeneBank: AF399587, BC069150, BK004527, HSHGMP07J, NM_012351   ORDB: ORL21   
Build #39 labels OR10J1
Chromosomal location 1:159,439,792-159,440,718 (+)
Cluster 1@159b
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10J2P 77.45% 306
OR10J8P 79.94% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10J8 80% 309
Chimp CONTIG519.161-1262 98% 309
Mouse Or10j2 80% 305
Rat Or10j2 79% 307
Cow OR10J1 81% 309
Cow OR10J2 80% 305
Cow OR10J1BP 89% 280

Expression evidences

Source Accession
ESTs DA686268
mRNA BC069150
GNF Atlas2 221346_at

Sequence information

Nucleotide sequence ATGAAAAGAGAGAACTTTACTCTCATCACTGACTTTGTTTTCCAAGGTTTCTCTAGCTTC
CATGAGCAGCAGATCACCCTTTTTGGCGTGTTCCTTGCACTATACATCTTAACCTTAGCA
GGCAATATCATCATTGTGACCATCATCCGAATGGATCTTCATCTTCACACACCCATGTAC
TTCTTCCTGAGCATGCTGTCCACTTCAGAGACTGTATATACATTGGTCATTCTCCCAAGA
ATGCTCTCCAGCCTCGTAGGTATGAGCCAGCCCATATCATTGGCAGGGTGTGCCACACAG
ATGTTCTTTTTTGTAACCTTTGGCATCACTAACTGCTTCCTGCTCACAGCAATGGGATAT
GACCGCTATGTGGCCATCTGCAACCCCCTGAGATACATGGTTATTATGAACAAGAGGCTG
CGTATCCAACTTGTCCTGGGGGCCTGCAGCATTGGGCTGATTGTAGCAATAACGCAAGTG
ACATCTGTATTCAGGTTACCCTTCTGTGCTAGAAAGGTGCCCCACTTCTTCTGTGACATC
CGCCCTGTGATGAAGCTCTCCTGCATTGACACCACTGTCAATGAAATCCTGACTTTGATT
ATCAGTGTGCTGGTGCTTGTTGTACCTATGGGTCTGGTTTTCATTTCTTATGTTCTCATT
ATCTCTACAATCCTCAAGATTGCTTCAGTTGAGGGCCGGAAGAAGGCTTTTGCCACCTGT
GCATCCCACCTCACTGTGGTCATTGTCCACTACAGCTGTGCCTCCATTGCCTACCTCAAG
CCCAAGTCAGAGAACACCAGAGAACATGACCAGCTGATCTCGGTGACCTACACTGTCATC
ACTCCCCTACTGAACCCTGTGGTATACACCCTGAGAAATAAAGAGGTCAAAGATGCTCTG
TGCAGGGCTGTTGGTGGGAAGTTTTCC
Conceptual translation MKRENFTLITDFVFQGFSSFHEQQITLFGVFLALYILTLAGNIIIVTIIRMDLHLHTPMY
FFLSMLSTSETVYTLVILPRMLSSLVGMSQPISLAGCATQMFFFVTFGITNCFLLTAMGY
DRYVAICNPLRYMVIMNKRLRIQLVLGACSIGLIVAITQVTSVFRLPFCARKVPHFFCDI
RPVMKLSCIDTTVNEILTLIISVLVLVVPMGLVFISYVLIISTILKIASVEGRKKAFATC
ASHLTVVIVHYSCASIAYLKPKSENTREHDQLISVTYTVITPLLNPVVYTLRNKEVKDAL
CRAVGGKFS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 nonsense SNP T/A C/* 1000GP (YRI)
1 100 -100 NS G/T M/I 1000GP (YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN C/T N/N 1000GP (YRI, YRI)
1 159,409,612 159,409,612 NS A/G N/D rs62641745 (DbSNP)
1 159,409,676 159,409,675 Ins(1) -/C rs35762410 (DbSNP)
1 159,409,734 159,409,734 NS G/T M/I rs10908722 (DbSNP)
1 159,409,757 159,409,757 NS C/T T/M rs35634161 (DbSNP)
1 159,409,857 159,409,857 NS A/G I/M rs12048482 (DbSNP)
1 159,409,884 159,409,884 NS A/G I/M rs12118628 (DbSNP)
1 159,409,965 159,409,965 SYN C/T N/N rs12070985 (DbSNP)
1 159,410,103 159,410,103 SYN C/G P/P rs62641747 (DbSNP)
1 159,410,217 159,410,217 SYN A/G L/L rs41264477 (DbSNP)
1 159,410,340 159,410,340 nonsense SNP A/T */C rs12409540 (DbSNP)
1 159,410,354 159,410,354 NS A/T Y/F rs41264479 (DbSNP)
1 159,439,920 159,439,920 SYN C/A I/I 1000GP (CHBJPT)
1 159,439,967 159,439,967 NS T/C M/T 1000GP (CEU, CHBJPT)
1 159,440,067 159,440,067 NS A/G I/M 1000GP (CEU, CHBJPT)
1 159,440,094 159,440,094 NS G/A M/I 1000GP (CEU, CHBJPT)
1 159,440,217 159,440,217 SYN C/T I/I 1000GP (CHBJPT)
1 159,440,427 159,440,427 SYN G/A L/L 1000GP (CEU)
1 159,440,550 159,440,550 nonsense SNP T/A C/* 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M218I M226T I259M M268I T277I M300R C264* Y269F % Freq CORP
1 I M M M T M C Y 45.70 0.347
2 I M I M T M C Y 27.34 0.347
3 I M I I T M C Y 13.52 0.347
4 I M I M T M * Y 7.14 1.200
5 I T I M T M C Y 3.61 0.347
6 M M I M T M C Y 0.84 0.347
7 I M I M I M C Y 0.77 0.347
8 I M M M T R C Y 0.69 0.347
9 I M M M T M C F 0.23 0.347
10 I M M M T M * Y 0.08 1.200
11 I M I I T M * Y 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10J1.aApr07-unspliced main_exon 5UTR chr1 159,439,722 159,439,792 +
CDS chr1 159,439,792 159,440,718 +
3UTR chr1 159,440,718 159,440,811 +