Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10J2P Olfactory Receptor

Gene Symbol OR10J2P1 (View this gene in GeneCards)
Family 10
Subfamily J
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR1.4.20P, ORL3069
External Ids HGNC: 14991   GeneBank: AB065446, NG_004364   ORDB: ORL3069   
Build #39 labels OR10J2P
Chromosomal location 1:159,279,044-159,280,001 (-)
Cluster 1@159b
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10J1 77.45% 306
OR10J8P 77.12% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10J2 80% 309
Chimp CONTIG705.103-5563 98% 320
Mouse Or10j2 85% 308
Rat Or10j2 84% 308
Cow OR10J2 85% 306

Expression evidences

Source Accession
GNF Atlas2 gnf1h10884_at

Sequence information

Nucleotide sequence TCTGTACTTTCAATCTGTTTATTTATCCAACGAAGAGAGAGAACCACACAGTGATAAGGG
AGTTTGTTTTCCAGGGTTTCTCCAGCTTTCATGAACACAAGCTTACCCTCTTTGTGGTAT
TTCTTACCTTGTGTCTTTTAACCCTGGCTGGCAATGTCATAATTGTGACAATTATCAGCA
TTGATCGTCACCTTCACACCCCCATGTACTTCTTTGTTAGTATGCTTTCCACTTCAGAGA
CTGTCTACACATTAGTCATTGTACCACGGATGCTCTCCAGTCTCTTAAGTCTAAGCCAAC
CTATCTCTTTGGGTGGCTGTGCCACCCAGATGTTTTTTTTATTACCTTGGCCATCAACAA
CTGCTTTCTGCTCACAGCAATGGGGTATGATCGCTATGTGGCCATCTGTAACCCTTTGAG
GTACATGATCATCATGAACAAGAAAGTGTGTGTCCAGCTGGTATGTGGGTCCTGCAGTGT
TGGGCTGCTTGTGGCCATAGTTCAGATTTCATCTGTGTTCAGGCTGCCTTTTTGTGATAA
ACAGGTGGCCCATTATTTCTGTGATATCCACCCAGTTATGAAACTTTCCTGTGTTGATAC
CACTCTACATGACCTAATTAATTTTGTTGTTAGTTCCCTGGTTATTGTGGTGCCGCTGGG
TTTGGTCTTCATCTCCTACATCCTCATCATCTCTACCATCCTCAAGGTCACCTCTCCTGA
GGGCCGGAAAAAGGCTTTTGCAACTTGTGCCTCCCACCTCACTGTGGTTATCATCCACTA
TGGCTGTGCCTCCATTGCCTACCTCAAGCCCAAGTCAGAGAACACCAGGGATCAGGACCA
GCTAATTTCAGTGACATACACCGTCTTTACTCCACTACTTAATCCTGTTGTGTACACTTT
GAGGAACAAGGAGGTCAAGAATGCCCTTCACCGTGCTATTGGCAAAAAACCTTTTGCC
Conceptual translation SVLSIC/IYPTKRENHTVIREFVFQGFSSFHEHKLTLFVVFLTLCLLTLAGNVIIVTII
SIDRHLHTPMYFFVSMLSTSETVYTLVIVPRMLSSLLSLSQPISLGGCATQM/FFITLA
INNCFLLTAMGYDRYVAICNPLRYMIIMNKKVCVQLVCGSCSVGLLVAIVQISSVFRLPF
CDKQVAHYFCDIHPVMKLSCVDTTLHDLINFVVSSLVIVVPLGLVFISYILIISTILKVT
SPEGRKKAFATCASHLTVVIIHYGCASIAYLKPKSENTRDQDQLISVTYTVFTPLLNPVV
YTLRNKEVKNALHRAIGKKPFA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI)
1 159,248,859 159,248,859 SNP C/T rs10489854 (DbSNP)
1 159,249,058 159,249,058 SNP C/T rs16841965 (DbSNP)
1 159,249,066 159,249,066 SNP C/T rs16841967 (DbSNP)
1 159,249,106 159,249,106 SNP A/T rs12135501 (DbSNP)
1 159,249,138 159,249,138 SNP A/G rs12087219 (DbSNP)
1 159,249,187 159,249,187 SNP C/G rs10489855 (DbSNP)
1 159,249,399 159,249,399 SNP C/G rs10458629 (DbSNP)
1 159,249,453 159,249,452 Ins(1) -/A rs67458903 (DbSNP)
1 159,249,460 159,249,459 Ins(1) -/A rs57414108 (DbSNP)
1 159,249,743 159,249,743 SNP G/T rs11265163 (DbSNP)
1 159,249,745 159,249,745 SNP G/T rs11265164 (DbSNP)
1 159,279,069 159,279,069 SNP C/T 1000GP (CEU, CHBJPT)
1 159,279,268 159,279,268 SNP C/T 1000GP (CHBJPT)
1 159,279,276 159,279,276 SNP C/T 1000GP (CEU, CHBJPT)
1 159,279,316 159,279,316 SNP T/A 1000GP (CEU)
1 159,279,348 159,279,348 SNP G/A 1000GP (CEU, CHBJPT)
1 159,279,397 159,279,397 SNP G/C 1000GP (CEU, CHBJPT)
1 159,279,953 159,279,953 SNP G/T 1000GP (CEU, CHBJPT)
1 159,279,955 159,279,955 SNP G/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
1 159,246,834 159,249,891 CopyNumber #28 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.