Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10K1 Olfactory Receptor

Gene Symbol OR10K11 (View this gene in GeneCards)
Family 10
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.36 (functional)
Aliases OR1-6, HsOR1.4.4, ORL3001
External Ids HGNC: 14693   GeneBank: AB065641, BK004190, NM_001004473   ORDB: ORL3001   
Build #39 labels OR10K1
Chromosomal location 1:158,465,562-158,466,500 (+)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10K2 83.77% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10K1 83% 311
Chimp CONTIG*********** 97% 313
Mouse Or10k2 80% 308
Rat Or10k2 78% 308
Cow OR10K1 87% 313
Cow OR10K2 81% 308
Cow OR10K1C 84% 308

Expression evidences

Source Accession
mRNA AB529282
GNF Atlas2 gnf1h10880_at

Sequence information

Nucleotide sequence ATGGAGCAAGTCAATAAGACTGTGGTGAGAGAGTTCGTCGTCCTCGGCTTCTCATCCCTG
GCCAGGCTGCAGCAGCTGCTCTTTGTTATCTTCCTGCTCCTCTACCTGTTCACTCTGGGC
ACCAATGCAATCATCATTTCCACCATTGTGCTGGACAGAGCCCTTCATACTCCCATGTAC
TTCTTCCTTGCCATCCTTTCTTGCTCTGAGATTTGCTATACCTTTGTCATTGTACCCAAG
ATGCTGGTTGACCTGCTGTCCCAGAAGAAGACCATTTCTTTCCTGGGCTGTGCCATCCAA
ATGTTTTCCTTCCTCTTCTTTGGCTCCTCTCACTCCTTCCTGCTGGCAGCCATGGGCTAT
GATCGCTATATGGCCATCTGTAACCCACTGCGCTACTCAGTGCTCATGGGACATGGGGTG
TGTATGGGACTAATGGCTGCTGCCTGTGCCTGTGGCTTCACTGTCTCCCTGGTCACCACC
TCCCTAGTATTTCATCTGCCCTTCCACTCCTCCAACCAGCTCCATCACTTCTTCTGTGAC
ATCTCCCCTGTCCTTAAACTGGCATCTCAGCACTCCGGCTTCAGTCAGCTGGTCATATTC
ATGCTTGGTGTATTTGCCTTGGTCATTCCTCTGCTACTTATCCTAGTCTCCTACATCCGC
ATCATCTCTGCCATTCTAAAAATCCCTTCCTCCGTTGGAAGATACAAGACCTTCTCCACC
TGTGCCTCCCATCTCATTGTGGTAACTGTTCACTACAGTTGTGCCTCTTTCATCTACTTA
AGGCCCAAGACTAATTACACTTCAAGCCAAGACACCCTAATATCTGTGTCATACACCATC
CTTACCCCATTGTTCAATCCAATGATTTATAGTCTGAGAAATAAGGAATTCAAATCAGCC
CTACGAAGAACAATCGGCCAAACTTTCTATCCTCTTAGT
Conceptual translation MEQVNKTVVREFVVLGFSSLARLQQLLFVIFLLLYLFTLGTNAIIISTIVLDRALHTPMY
FFLAILSCSEICYTFVIVPKMLVDLLSQKKTISFLGCAIQMFSFLFFGSSHSFLLAAMGY
DRYMAICNPLRYSVLMGHGVCMGLMAAACACGFTVSLVTTSLVFHLPFHSSNQLHHFFCD
ISPVLKLASQHSGFSQLVIFMLGVFALVIPLLLILVSYIRIISAILKIPSSVGRYKTFST
CASHLIVVTVHYSCASFIYLRPKTNYTSSQDTLISVSYTILTPLFNPMIYSLRNKEFKSA
LRRTIGQTFYPLS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/T T/I 1000GP (YRI)
1 100 -100 SYN G/C V/V 1000GP (YRI, YRI, YRI)
1 158,435,501 158,435,501 SYN C/G V/V rs6691971 (DbSNP)
1 158,435,927 158,435,927 SYN A/C S/S rs16840204 (DbSNP)
1 158,435,928 158,435,928 NS A/G S/G rs41273489 (DbSNP)
1 158,466,137 158,466,137 SYN C/A S/S 1000GP (CHBJPT)
1 158,466,138 158,466,138 NS G/A G/S 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T74I S103P N172S G193S I221M Y310C % Freq CORP
1 T S N G I Y 91.32 0.501
2 T S N S I Y 4.76 0.501
3 I S N G I Y 3.15 0.501
4 T P N G I Y 0.31 0.501
5 T S S G I Y 0.23 0.501
6 I S N G I C 0.08 0.501
7 T S N G M Y 0.08 0.501
8 I P N G I Y 0.08 0.501

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10K1.aApr07-unspliced main_exon CDS chr1 158,465,562 158,466,500 +
3UTR chr1 158,466,500 158,466,503 +