Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10K2 Olfactory Receptor

Gene Symbol OR10K21 (View this gene in GeneCards)
Family 10
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.21 (functional)
Aliases OR1-4, HsOR1.4.2, ORL3023
External Ids HGNC: 14826   GeneBank: BK004363, NM_001004476   ORDB: ORL3023   
Build #39 labels OR10K2
Chromosomal location 1:158,419,931-158,420,866 (-)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10K1 83.77% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10K2 82% 311
Chimp CONTIG*********** 85% 308
Chimp CONTIG705.11-360 96% 276
Mouse Or10k2 81% 311
Rat Or10k2 81% 311
Cow OR10K2 85% 311

Expression evidences

Source Accession
GNF Atlas2 gnf1h03678_at

Sequence information

Nucleotide sequence ATGGAGCGGGTCAATGAGACTGTGGTGAGAGAGGTCATCTTCCTCGGCTTCTCATCCCTG
GCCAGGCTGCAGCAGCTGCTCTTTGTTATCTTCCTGCTCCTCTACCTGTTCACTCTGGGC
ACCAATGCAATCATCATTTCCACCATTGTCCTGGACAGGGCCCTTCATATCCCCATGTAC
TTCTTCCTTGCCATCCTCTCTTGCTCTGAGATTTGCTACACCTTCATCATTGTACCCAAG
ATGCTGGTTGACCTGCTGTCCCAGAAGAAGACCATTTCTTTCCTGGGCTGTGCCATCCAA
ATGTTTTCCTTCCTCTTCCTTGGCTGCTCTCACTCCTTTCTGCTGGCAGTCATGGGTTAT
GATCGTTACATAGCCATCTGTAACCCACTGCGCTACTCAGTGCTAATGGGACATGGGGTG
TGTATGGGACTAGTGGCTGCTGCCTGTGCCTGTGGCTTCACTGTTGCACAGATCATCACA
TCCTTGGTATTTCACCTGCCTTTTTATTCCTCCAATCAACTACATCACTTCTTCTGTGAC
ATTGCTCCTGTCCTCAAGCTGGCATCTCACCATAACCACTTTAGTCAGATTGTCATCTTC
ATGCTCTGTACATTGGTCCTGGCTATCCCCTTATTGTTGATCTTGGTGTCCTATGTTCAC
ATCCTCTCTGCCATACTTCAGTTTCCTTCCACACTGGGTAGGTGCAAAGCTTTTTCTACC
TGTGTATCTCACCTCATTATTGTCACTGTCCACTATGGCTGTGCCTCCTTTATCTACTTA
AGGCCTCAGTCCAACTACTCCTCAAGCCAGGATGCTCTAATATCAGTATCCTACACTATT
ATAACTCCATTGTTCAACCCAATGATTTATAGCTTGAGAAATAAAGAGTTCAAATCAGCT
CTTTGTAAAATTGTGAGAAGAACAATTTCCCTGTTG
Conceptual translation MERVNETVVREVIFLGFSSLARLQQLLFVIFLLLYLFTLGTNAIIISTIVLDRALHIPMY
FFLAILSCSEICYTFIIVPKMLVDLLSQKKTISFLGCAIQMFSFLFLGCSHSFLLAVMGY
DRYIAICNPLRYSVLMGHGVCMGLVAAACACGFTVAQIITSLVFHLPFYSSNQLHHFFCD
IAPVLKLASHHNHFSQIVIFMLCTLVLAIPLLLILVSYVHILSAILQFPSTLGRCKAFST
CVSHLIIVTVHYGCASFIYLRPQSNYSSSQDALISVSYTIITPLFNPMIYSLRNKEFKSA
LCKIVRRTISLL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS G/A L/F 1000GP (YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN A/T I/I 1000GP (YRI, YRI, YRI)
1 158,390,035 158,390,035 NS C/T A/T rs12240099 (DbSNP)
1 158,390,119 158,390,119 NS C/T D/N rs73019729 (DbSNP)
1 158,390,229 158,390,229 NS A/C V/G rs73019731 (DbSNP)
1 158,390,252 158,390,252 SYN G/T L/L rs12239443 (DbSNP)
1 158,390,501 158,390,501 SYN A/G D/D rs34616883 (DbSNP)
1 158,420,462 158,420,462 SYN T/G L/L 1000GP (CEU, CHBJPT)
1 158,420,711 158,420,711 SYN G/A D/D 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G253S L222F P210R A208T D180N G143V % Freq CORP
1 G L P A D G 97.39 0.309
2 G L R T N V 1.00 0.165
3 S L P A D G 0.84 0.309
4 G F P A D G 0.61 0.309
5 G L R T N G 0.15 0.165

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10K2.aApr07-unspliced main_exon 3UTR chr1 158,419,928 158,419,931 -
CDS chr1 158,419,931 158,420,866 -