Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10Q1 Olfactory Receptor

Gene Symbol OR10Q11 (View this gene in GeneCards)
Family 10
Subfamily Q
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases OR11-233, HsOR11.12.11, ORL3393
External Ids HGNC: 15134   GeneBank: AB065735, BK004298, NM_001004471   ORDB: ORL3393   
Build #39 labels OR10Q1
Chromosomal location 11:58,227,919-58,228,875 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10Q2P 86.47% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10Q1 86% 313
Dog OR10Q2 83% 312
Chimp CONTIG229.242-63986 97% 319
Mouse Or10q1 84% 314
Mouse Or10q1b 82% 316
Rat Or10q1 84% 311
Cow OR10Q1 84% 311

Expression evidences

Source Accession
mRNA AB529284

Sequence information

Nucleotide sequence ATGCCTGTGGGGAAACTTGTCTTCAACCAGTCTGAGCCCACTGAGTTTGTGTTCCGTGCG
TTCACCACAGCCACTGAATTCCAGGTTCTTCTCTTCCTTCTCTTCCTCCTCCTCTACTTG
ATGATCCTCTGTGGCAACACAGCCATCATCTGGGTGGTGTGCACACACAGCACCCTCCGC
ACCCCGATGTATTTCTTCCTGTCCAACCTGTCTTTCCTGGAACTCTGCTACACCACCGTG
GTAGTACCCTTGATGCTTTCCAACATTTTGGGGGCCCAGAAGCCCATTTCGTTGGCTGGA
TGTGGGGCCCAAATGTTCTTCTTTGTCACCCTCGGCAGCACGGACTGTTTCCTCTTGGCG
ATCATGGCCTATGACCGCTATGTGGCTATCTGCCACCCGCTGCACTACACCCTCATCATG
ACCCGCGAGCTGTGCACGCAGATGCTGGGTGGGGCCCTGGGCCTGGCCCTCTTCCCCTCC
CTGCAGCTCACCGCCTTAATCTTCACCCTGCCCTTTTGCGGCCACCACCAGGAAATCAAC
CACTTCCTCTGCGATGTGCCTCCCGTCCTGCGCCTGGCCTGCGCTGACATCCGCGTGCAC
CAGGCTGTCCTCTATGTCGTGAGCATCCTCGTGCTGACCATCCCCTTCCTGCTCATCTGC
GTCTCCTACGTGTTCATCACCTGTGCCATCCTGAGCATCCGTTCTGCCGAGGGCCGCCGC
CGGGCCTTCTCCACCTGCTCCTTCCACCTCACCGTGGTCCTGCTGCAGTATGGCTGCTGC
AGCCTCGTGTACCTGCGTCCTCGGTCCAGCACCTCAGAGGATGAGGACAGCCAAATCGCG
TTGGTCTACACCTTTGTCACCCCCTTACTCAACCCTTTGCTTTACAGCCTTAGGAACAAG
GATGTCAAAGGTGCTCTGAGGAGTGCCATTATCCGTAAAGCAGCCTCTGACGCCAAC
Conceptual translation MPVGKLVFNQSEPTEFVFRAFTTATEFQVLLFLLFLLLYLMILCGNTAIIWVVCTHSTLR
TPMYFFLSNLSFLELCYTTVVVPLMLSNILGAQKPISLAGCGAQMFFFVTLGSTDCFLLA
IMAYDRYVAICHPLHYTLIMTRELCTQMLGGALGLALFPSLQLTALIFTLPFCGHHQEIN
HFLCDVPPVLRLACADIRVHQAVLYVVSILVLTIPFLLICVSYVFITCAILSIRSAEGRR
RAFSTCSFHLTVVLLQYGCCSLVYLRPRSSTSEDEDSQIALVYTFVTPLLNPLLYSLRNK
DVKGALRSAIIRKAASDAN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T A/T 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A N/N 1000GP (YRI)
11 57,995,777 57,995,777 NS A/G C/R rs11229301 (DbSNP)
11 57,996,084 57,996,084 SYN A/G N/N rs61902844 (DbSNP)
11 57,996,312 57,996,312 NS C/G E/D rs4245219 (DbSNP)
11 58,228,305 58,228,305 NS G/A R/C 1000GP (CEU, CHBJPT)
11 58,228,612 58,228,612 SYN G/A N/N 1000GP (CEU, CHBJPT)
11 58,228,840 58,228,840 NS C/G E/D 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 124 (Hasin)
11 57,993,391 57,996,447 CopyNumber #73 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A318T R191C L67M % Freq CORP
1 A R L 83.72 0.029
2 A C L 13.29 0.029
3 T R L 2.69 0.029
4 A R M 0.31 0.014

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10Q1.aApr07-unspliced main_exon 3UTR chr11 58,227,916 58,227,919 -
CDS chr11 58,227,919 58,228,875 -