Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10R3P Olfactory Receptor

Gene Symbol OR10R3P1 (View this gene in GeneCards)
Family 10
Subfamily R
Pseudogene Yes
CORP pseudogene probability score
Aliases OR1-9, HsOR1.4.6P, ORL3058
External Ids HGNC: 14829   GeneBank: AB065639, AF399451, BK004673, NG_004362   ORDB: ORL3058   
Build #39 labels OR10R3P
Chromosomal location 1:158,491,219-158,492,157 (+)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10R2 76.38% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10R3 86% 313
Dog OR10R3B 85% 313
Dog OR10R3C 84% 313
Chimp CONTIG*********** 96% 313
Mouse Or10k2 55% 304
Rat Or10j2 55% 305
Cow OR10R3 86% 306

Expression evidences

Source Accession
ESTs DB107535
mRNA AB529255

Sequence information

Nucleotide sequence ATGGCCAATTCTTCCTCTGTCACTGAGTTCTTAGTGCTGGGCTTCTCTAGCCTTGGGGAA
TTGCAGCTTGTCCTCTTTGCAGTCTTTCTCTGCCTCTATTTGATTATCTTGAGTGGAAAC
ATCATCATCATCTCAGTCATTCATTTGGATCACAGCCTCCACACACCCATGTACTTCTTT
CTAGGTATTCTTTCTATCTCTGAAATCTTCTACACAACTGTTATTCTGCCCAAGATGCTT
ATCAACTTATTCTCTGTATTCAGGACACTCTCCTTTGTGAGTTGTGCCACCCAAATGTTC
TTCTTCCTCGGTTTTGCTGTCACTAACTGTCTGCTTCTGGGAGTGATGGGTTATGATCGT
TATGCTGCCATCTGTCAGCCTTTGCAATACGCTGTTCTCATGAGCTGGAGAGTATGTGGA
CAACTGATAGCAACTTGTATTATTAGTGGCTTCCTAATATCTCTGGTGGGAACAACTTTT
GTCTTTAGCCTCCCTTTCTGTGGCTCCAACAAGGTCAACCACTACTTTTGTGATATTTCA
CCAGTTATCCGTCTCGCCTGTGCTGACAGCTACATCAGTGAACTGGTCATCTTCATCTTC
GGGGTCTTGGTGCTTGTTGTGCCCTTGATATTTATCTGCATTTCCTATGGCTTCATTGTC
CGCACCATCCTGAAGATCCCATCAGCTGAAGGCAAACAAAAAGCCTTCTCCACCTGTGCT
TCCCATCTCATTGTAGTCATTGTCCATTATGGTTGAGCTTCCTTTGTCTACTTGCGACCC
TCAGCCAAATATACATCGGGCAAAGATAGGCTGGTGACAGTGACCTATACCATCATCACC
CCAGTCTTGAACCCCATGGTATACAGCCTCAGGAACAACGATGTGCAGATGGCTATTCGG
AAACTGATTGGAAAGTCTGGGTTTTCTCTTAAGACTCTA
Conceptual translation MANSSSVTEFLVLGFSSLGELQLVLFAVFLCLYLIILSGNIIIISVIHLDHSLHTPMYFF
LGILSISEIFYTTVILPKMLINLFSVFRTLSFVSCATQMFFFLGFAVTNCLLLGVMGYDR
YAAICQPLQYAVLMSWRVCGQLIATCIISGFLISLVGTTFVFSLPFCGSNKVNHYFCDIS
PVIRLACADSYISELVIFIFGVLVLVVPLIFICISYGFIVRTILKIPSAEGKQKAFSTCA
SHLIVVIVHYGXSFVYLRPSAKYTSGKDRLVTVTYTIITPVLNPMVYSLRNNDVQMAIR
KLIGKSGFSLKTL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 158,461,016 158,461,016 SNP A/G rs10908656 (DbSNP)
1 158,461,205 158,461,205 SNP C/T rs16840274 (DbSNP)
1 158,461,366 158,461,366 SNP T/C rs1873511 (DbSNP)
1 158,461,398 158,461,398 SNP C/T rs61740024 (DbSNP)
1 158,461,417 158,461,417 SNP A/C rs61740028 (DbSNP)
1 158,461,418 158,461,418 SNP G/A rs1873510 (DbSNP)
1 158,461,528 158,461,528 SNP C/G rs61732270 (DbSNP)
1 158,461,563 158,461,563 SNP T/C rs1873509 (DbSNP)
1 158,461,888 158,461,888 SNP G/T rs4356044 (DbSNP)
1 158,491,226 158,491,226 SNP A/G 1000GP (CEU, CHBJPT)
1 158,491,576 158,491,576 SNP C/T 1000GP (CEU, CHBJPT)
1 158,491,628 158,491,628 SNP G/A 1000GP (CEU, CHBJPT)
1 158,491,725 158,491,725 SNP C/T 1000GP (CEU)
1 158,491,773 158,491,773 SNP C/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 60 (Hasin)
1 158,460,909 158,463,947 Deletion #177 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10R3P.aApr07-unspliced main_exon CDS_partial chr1 158,491,451 158,492,157 +
3UTR chr1 158,492,157 158,493,480 +