Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10S1 Olfactory Receptor

Gene Symbol OR10S11 (View this gene in GeneCards)
Family 10
Subfamily S
Pseudogene No
CORP pseudogene probability score 0.76 (pseudogene)
Aliases OR11-279, HsOR11.18.8, ORL3374, ORL3375
External Ids HGNC: 14807   GeneBank: AB065758, AF399565, BK004509, NM_001004474   ORDB: ORL3374, ORL3375   
Build #39 labels OR10S1
Chromosomal location 11:123,976,699-123,977,658 (-)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10G1P 57.38% 298
OR10G4 54.52% 299
OR10G7 54.18% 299

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10S1 84% 320
Chimp CONTIG708.120-4159 98% 320
Mouse Or10s1 87% 314
Rat Or10s1 84% 317
Cow OR10S1 85% 273

Expression evidences

Source Accession
mRNA BC137038
GNF Atlas2 gnf1h05562_at

Sequence information

Nucleotide sequence ATGACAACGGAGAACCCCAACCAGACTGTGGTGAGCCACTTCTTCCTGGAGGGTTTGAGG
TACACCGCTAAACATTCTAGCCTCTTCTTCCTCCTCTTCCTCCTCATCTACAGCATCACT
GTGGCTGGGAATCTCCTCATCCTCCTAACTGTGGGCTCTGACTCTCACCTCAGCTTACCC
ATGTACCACTTCCTGGGGCACCTCTCCTTCCTGGATGCCTGTTTGTCTACAGTGACAGTG
CCCAAGGTCATGGCAGGCCTGCTGACTCTGGATGGGAAGGTGATCTCCTTTGAGGGCTGT
GCCGTACAGCTTTATTGCTTCCACTTTCTGGCCAGCACTGAGTGCTTCCTGTACACAGTC
ATGGCCTATGACCGCTATCTGGCTATCTGTCAACCCCTGCACTACCCAGTGGCCATGAAC
AGAAGGATGTGTGCAGAAATGGCTGGAATCACCTGGGCCATAGGTGCCACGCACGCTGCA
ATCCACACCTCCCTCACCTTCCGCCTGCTCTACTGTGGGCCTTGCCACATTGCCTACTTC
TTCTGCGACATACCCCCTGTCCTAAAGCTCGCCTGTACAGACACCACCATTAATGAGCTA
GTCATGCTTGCCAGCATTGGCATCGTGGCTGCAGGCTGCCTCATCCTCATCGTTATTTCC
TACATCTTCATCGTGGCAGCTGTGTTGCGCATCCGCACAGCCCAGGGCCGGCAGCGGGCC
TTCTCCCCCTGCACTGCCCAGCTCACTGGGGTGCTCCTGTACTACGTGCCACCTGTCTGT
ATCTACCTGCAGCCTCGCTCCAGTGAGGCAGGAGCTGGGGCCCCTGCTGTCTTCTACACA
ATCGTAACTCCAATGCTCAACCCATTCATTTACACTTTGCGGAACAAGGAGGTGAAGCAT
GCTCTGCAAAGGCTTTTGTGCAGCAGCTTCCGAGAGTCTACAGCAGGCAGCCCACCCCCA
Conceptual translation MTTENPNQTVVSHFFLEGLRYTAKHSSLFFLLFLLIYSITVAGNLLILLTVGSDSHLSLP
MYHFLGHLSFLDACLSTVTVPKVMAGLLTLDGKVISFEGCAVQLYCFHFLASTECFLYTV
MAYDRYLAICQPLHYPVAMNRRMCAEMAGITWAIGATHAAIHTSLTFRLLYCGPCHIAYF
FCDIPPVLKLACTDTTINELVMLASIGIVAAGCLILIVISYIFIVAAVLRIRTAQGRQRA
FSPCTAQLTGVLLYYVPPVCIYLQPRSSEAGAGAPAVFYTIVTPMLNPFIYTLRNKEVKH
ALQRLLCSSFRESTAGSPPP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/G V/A 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN T/G P/P 1000GP (YRI)
11 123,847,473 123,847,473 NS A/G V/A rs55944888 (DbSNP)
11 123,847,659 123,847,659 NS C/T G/D rs35682880 (DbSNP)
11 123,848,064 123,848,064 NS A/G V/A rs17759447 (DbSNP)
11 123,848,110 123,848,110 NS A/C C/G rs11219384 (DbSNP)
11 123,848,121 123,848,121 NS C/T R/K rs17686210 (DbSNP)
11 123,848,212 123,848,212 NS C/T G/S rs17759513 (DbSNP)
11 123,976,766 123,976,766 NS A/G V/A 1000GP (CEU, CHBJPT)
11 123,977,414 123,977,414 NS T/C K/R 1000GP (CEU, CHBJPT)
11 123,977,505 123,977,505 NS C/T G/S 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V309A A281T I230T A112V K93R G63S % Freq CORP
1 V A I A K G 76.04 0.866
2 A A I A R S 12.44 0.866
3 V A I A R S 7.99 0.866
4 V T I A K G 1.84 0.866
5 V A I A R G 1.00 0.866
6 V A T A K G 0.31 0.866
7 V A I V K G 0.23 0.866
8 A A I A K G 0.15 0.866

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10S1.aApr07-unspliced main_exon 3UTR chr11 123,976,696 123,976,699 -
CDS chr11 123,976,699 123,977,658 -
5UTR chr11 123,977,658 123,977,691 -