Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10W1 Olfactory Receptor

Gene Symbol OR10W11 (View this gene in GeneCards)
Family 10
Subfamily W
Pseudogene No
CORP pseudogene probability score 0.13 (functional)
Aliases OR11-236, HsOR11.12.12
External Ids HGNC: 15139   GeneBank: AB065850, AY358251, BK004490, NG_004246, NM_207374   
Build #39 labels OR10W1P
Chromosomal location 11:58,266,944-58,267,858 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10Q1 53.64% 302
OR10Q2P 56.85% 292

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10W1 85% 305
Chimp CONTIG229.247-5672 97% 305
Mouse Or10w1 81% 304
Rat Or10w1 80% 304
Cow OR10W4 76% 305

Expression evidences

Source Accession
mRNA AB529287
GNF Atlas2 gnf1h02104_s_at

Sequence information

Nucleotide sequence ATGGAATTTGTGTTCCTGGCCTATCCCTCCTGCCCAGAACTGCATATTCTGTCCTTCCTT
GGGGTCAGCCTGGTTTATGGTTTGATCATCACTGGGAACATTCTCATTGTGGTGTCCATT
CACACAGAAACCTGTCTATGCACATCCATGTACTATTTCCTGGGCAGCCTTTCTGGGATT
GAAATATGCTACACTGCAGTGGTGGTGCCCCATATCCTGGCCAACACCCTACAGTCAGAG
AAGACCATCACTCTCCTGGGCTGTGCCACCCAGATGGCTTTCTTCATTGCACTGGGCAGT
GCTGATTGCTTCCTCTTGGCTGCCATGGCCTATGACCGCTATGTGGCCATTTGCCACCCG
TTGCAGTACCCTCTCCTCATGACATTGACTCTTTGTGTCCACTTGGTTGTGGCATCAGTC
ATCAGTGGTCTGTTCCTGTCCTTACAACTGGTGGCCTTCATCTTCTCTCTGCCATTCTGC
CAGGCTCAGGGCATTGAGCACTTCTTTTGTGATGTGCCACCAGTCATGCATGTTGTTTGT
GCTCAGAGTCACATTCATGAGCAGTCAGTGCTGGTGGCAGCCATACTAGCCATTGCTGTG
CCTTTCTTCCTCATCACCACCTCCTACACCTTCATAGTGGCTGCTCTGCTCAAGATCCAC
TCGGCTGCTGGCCGCCACCGGGCCTTCTCCACCTGCTCTTCCCACCTCACTGTGGTGCTG
CTGCAGTATGGCTGCTGTGCCTTCATGTACCTGTGCCCCAGCTCCAGCTACAACCCCAAG
CAAGATCGGTTCATCTCACTGGTGTACACATTGGGAACCCCACTGCTCAACCCACTTATC
TATGCCCTGAGGAACAGTGAGATGAAAGGGGCCGTAGGGAGAGTTCTTACCAGGAACTGC
CTTTCCCAGAACAGC
Conceptual translation MEFVFLAYPSCPELHILSFLGVSLVYGLIITGNILIVVSIHTETCLCTSMYYFLGSLSGI
EICYTAVVVPHILANTLQSEKTITLLGCATQMAFFIALGSADCFLLAAMAYDRYVAICHP
LQYPLLMTLTLCVHLVVASVISGLFLSLQLVAFIFSLPFCQAQGIEHFFCDVPPVMHVVC
AQSHIHEQSVLVAAILAIAVPFFLITTSYTFIVAALLKIHSAAGRHRAFSTCSSHLTVVL
LQYGCCAFMYLCPSSSYNPKQDRFISLVYTLGTPLLNPLIYALRNSEMKGAVGRVLTRNC
LSQNS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T R/Q 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A F/F 1000GP (YRI)
11 58,034,543 58,034,543 NS C/T R/Q rs10792156 (DbSNP)
11 58,034,597 58,034,597 NS C/G C/S rs56302613 (DbSNP)
11 58,034,635 58,034,635 NS T/G multi/C rs61998229 (DbSNP)
11 58,034,651 58,034,651 NS C/T R/Q rs7111538 (DbSNP)
11 58,034,722 58,034,722 SYN A/G F/F rs12284213 (DbSNP)
11 58,267,071 58,267,071 NS C/T R/Q 1000GP (CEU, CHBJPT)
11 58,267,179 58,267,179 NS C/T R/Q 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 187 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R263Q D262Y % Freq CORP
1 R D 50.00 0.313
2 Q D 49.92 0.313
3 Q Y 0.08 0.313

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10W1.aApr07-unspliced main_exon 3UTR chr11 58,266,792 58,266,944 -
CDS chr11 58,266,944 58,267,858 -
5UTR chr11 58,267,858 58,268,260 -