Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10X1 Olfactory Receptor

Gene Symbol OR10X11 (View this gene in GeneCards)
Family 10
Subfamily X
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR1-14, OR1-13, HsOR1.4.9
External Ids HGNC: 14995   GeneBank: AB065636, AF399455, BK004194, BK004529, NM_001004477   
Build #39 labels OR10X1P
Chromosomal location 1:158,578,922-158,579,848 (-)
Cluster 1@159a
Synteny CLIC#4
Remarks Segregating Pseudo Gene, a nonsynonymous SNP rs863362 (AA change=W/* )

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10H1 50% 302
OR10H2 49.51% 309
OR10R3P 50.66% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10X1 83% 310
Chimp CONTIG*********** 97% 168
Mouse Or10x1 83% 310
Rat Or10x1b 83% 310
Rat Or10x1 82% 309
Cow OR10X1 85% 304
Cow OR10X1C 83% 310
Cow OR10X1D 84% 310

Sequence information

Nucleotide sequence ATGAAGATCAACCAGACAATCCTGAAGGAATTCATTCTTGTTGGCTTTTCTGTGTACCCA
CATGTACAGACATTTCTTTTTGTGGTCTTCTTTTGTCTCTACCTTCTCACCCTTGCAGGT
AATCTGATCATCATGGGTCTAACTTGGGTGGACAGGTCCCTCCACACCCCTATGTATCTC
TTCCTTAGTGCACTCTCCTTCTCTGAGACCTGCTATACGCTGACCATCGTCCCCAAGATG
CTGGAAGATCTACTGGCCAAGGACAGAAGCATTTCAGTCACAGGTTGTAGCTTACAGATG
TGCTTCTTCTTGGGACTTGGTGGCACAAACTGTATCATTCTCACTTTGATGGGATATGAC
CGCTTCCTGGCCATCTGTAACCCTCTAAGATATCCACTGCTTATGACCAACATTGTATGT
GGACAACTTGTGGCCTCTGCTTGCACTGCAGGCTTCTTTATCTCTCTTACAGAGACTGCA
CTGATATTCAGGGACTCTTTCTGCAGACCCAACCTTGTCAAACACTTCTTCTGCCATATG
CTGGCAGTTATTAGGCTGTCTTGTATAGACAGTAACCACACAGAATTCATTATAACACTG
ATCTCAGTGTCTGGTTTGCTGGGTACCCTTCTGCTCATCATCCTGACTGATGTCTTCATT
ATTTCTACTGTCCTCAGGATCCCTTCAGCTGAGGGCAAGCAGAAGGCCTTCACCACCTGT
GCCTCCCACCTCACCGTGGTTATAATCCACTTTGGTTTTGCATCTATTGTTTATTTGAAG
CCAGAAGCCTCAGGAGATGACACACTCATAGCAGTCCCTTATACTGTCATTACCCCCTTC
CTCAGCCCCATCATATTCAGCCTGAGGAATAAGGACATGAAAAATGCTTTTAGAAGAATG
ATGGGAAACACAGTTGCCTTGAAAAAA
Conceptual translation MKINQTILKEFILVGFSVYPHVQTFLFVVFFCLYLLTLAGNLIIMGLTWVDRSLHTPMYL
FLSALSFSETCYTLTIVPKMLEDLLAKDRSISVTGCSLQMCFFLGLGGTNCIILTLMGYD
RFLAICNPLRYPLLMTNIVCGQLVASACTAGFFISLTETALIFRDSFCRPNLVKHFFCHM
LAVIRLSCIDSNHTEFIITLISVSGLLGTLLLIILTDVFIISTVLRIPSAEGKQKAFTTC
ASHLTVVIIHFGFASIVYLKPEASGDDTLIAVPYTVITPFLSPIIFSLRNKDMKNAFRRM
MGNTVALKK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 nonsense SNP C/T W/* 1000GP (YRI)
1 100 -100 NS C/T V/M 1000GP (YRI, YRI, YRI, YRI)
1 100 -100 SYN G/A P/P 1000GP (YRI, YRI, YRI)
1 158,548,788 158,548,788 NS A/G I/T rs72698782 (DbSNP)
1 158,548,802 158,548,802 SYN A/G P/P rs36102561 (DbSNP)
1 158,548,903 158,548,903 NS C/T V/M rs73016227 (DbSNP)
1 158,548,922 158,548,922 SYN C/G T/T rs36024740 (DbSNP)
1 158,548,931 158,548,931 SYN A/G A/A rs35360113 (DbSNP)
1 158,549,082 158,549,082 NS A/T L/Q rs61755876 (DbSNP)
1 158,549,151 158,549,151 NS A/C F/C rs41273505 (DbSNP)
1 158,549,152 158,549,152 NS A/G F/L rs16840360 (DbSNP)
1 158,549,176 158,549,176 NS A/G S/P rs7550131 (DbSNP)
1 158,549,264 158,549,264 SYN A/G I/I rs863360 (DbSNP)
1 158,549,277 158,549,277 NS C/T R/H rs41273507 (DbSNP)
1 158,549,339 158,549,339 NS C/T M/I rs41273509 (DbSNP)
1 158,549,402 158,549,401 Ins(1) -/A rs35095271 (DbSNP)
1 158,549,420 158,549,420 SYN C/T T/T rs863361 (DbSNP)
1 158,549,449 158,549,449 NS C/A A/S rs950164 (DbSNP)
1 158,549,492 158,549,492 nonsense SNP C/T W/* rs863362 (DbSNP)
1 158,549,511 158,549,511 NS A/G I/T rs863363 (DbSNP)
1 158,579,420 158,579,420 SYN A/G L/L 1000GP (CEU)
1 158,579,474 158,579,474 SYN G/A I/I 1000GP (CEU, CHBJPT)
1 158,579,549 158,579,549 NS C/T M/I 1000GP (CEU)
1 158,579,630 158,579,630 SYN C/T T/T 1000GP (CEU, CHBJPT)
1 158,579,631 158,579,631 NS G/A T/M 1000GP (CEU)
1 158,579,659 158,579,659 NS C/A A/S 1000GP (CEU)
1 158,579,702 158,579,702 nonsense SNP C/T W/* 1000GP (CEU, CHBJPT)
1 158,579,721 158,579,721 NS A/G I/T 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V246M S204A L186Q S155P T73M A64S W49* I43T I7V % Freq CORP
1 V S L S T A * T I 51.00 1.200
2 V S L S T A W I I 40.94 1.000
3 V S L S M A W I I 4.38 1.000
4 M S L S T A * T I 1.77 1.200
5 V S Q S T A W T I 1.00 1.000
6 V S L P T A * T I 0.46 1.200
7 V S L S T S W I I 0.31 1.000
8 V S L S T A W I V 0.08 1.000
9 M A L S T A * T I 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10X1.aApr07-unspliced main_exon 3UTR chr1 158,578,919 158,578,922 -
CDS chr1 158,578,922 158,579,848 -
5UTR chr1 158,579,848 158,579,899 -